KEGG   Photobacterium profundum: PBPRB0258Help
Entry
PBPRB0258         CDS       T00173                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppr  Photobacterium profundum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PBPRB0258
  Lipid metabolism
   00561 Glycerolipid metabolism
    PBPRB0258
   00600 Sphingolipid metabolism
    PBPRB0258
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PBPRB0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:292315..293670
Genome map
AA seq 451 aa AA seqDB search
MKTPQITFIGAGSTIFVKNILGDVFHKPALKHAHIALMDIDQTRLEESQIVVRKLMESAG
ATGNITCHLNQKDALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLDQTIADTLGPGGIM
RSLRTIPHLWQICEDMTEVCPDATMLNYVNPMAMNTWAMYAKYPNIKQVGLCHSVQGTAE
ELARDLELDYNDLRYTCAGINHMAYYLTLEKKNAQGEYVDIYPDLLTAFENGQAPKPGQH
HNGRCVNLIRYEMFKKLGYFVTESSEHFAEYTPYFIKPNRPDLIERYKVPLDEYPKRCVE
QIADWKQDLEAFKNADSIDVKESHEYASTIMNAIWTGTPSVIYGNVKNDGLIENLPQECC
VEVACLVDANGIQPTKVGRLPNHLAALMQTNINVQTLLTEAILTENRDRIYHAVMLDPHT
AAVLGLEEIYALVDDLIEAHEGWLPAWVNKH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagactccacaaattaccttcatcggtgcgggttcgactattttcgttaagaacatt
cttggcgacgtttttcataaaccagcactgaagcatgcccatattgcattgatggatatc
gatcaaactcgcttagaagaatctcagatcgttgttagaaagctcatggaatctgctggt
gcgacaggcaatataacctgtcacctgaatcaaaaagatgctctgcaagatgccgatttt
gtcgttgttgcatttcagattggcggttacgagccgtgtactgttactgattttgaggtc
tgtaagcgtcacggtctagatcaaactattgctgataccttaggccctggcggcattatg
cgttcattacgtactattcctcatttatggcagatctgtgaagacatgaccgaggtttgc
cctgatgcaaccatgcttaattatgtgaatccgatggcgatgaatacttgggcgatgtat
gcaaaatacccaaatattaaacaggttggtctttgccattctgtgcaaggtaccgctgaa
gaattggcgcgtgacttagagttggattataacgatttacgttatacctgtgccggtatt
aaccatatggcttattacctcacattagagaagaaaaacgcgcaaggtgagtatgtggat
atttaccctgacttactgacggcctttgaaaatggtcaagcccctaaacctggccaacat
cataacggtcgttgcgtaaacctcattcgttatgaaatgttcaaaaagctgggctacttt
gtgactgaatcgtcagagcattttgccgaatacaccccgtacttcattaaaccaaatcgc
cctgatttgattgaacgttataaagtgccactagatgagtatccgaaacgttgtgttgag
caaatagctgattggaagcaagatctggaagcgtttaaaaacgcagatagtatcgatgtg
aaagaatctcacgaatacgcaagcacgatcatgaatgccatctggacgggcacgccgagc
gtgatttacggcaacgttaaaaatgatggtctgattgaaaacttaccgcaagagtgttgt
gtggaagttgcctgtctggttgatgctaacggtattcaaccgacgaaagtaggtcgctta
ccaaaccatctggcggcattaatgcaaaccaatattaatgttcaaaccctactgactgaa
gctatcttaactgaaaatagagatcgcatttatcacgccgtcatgctggatccgcatact
gcggcagtattagggctagaagagatctatgcactcgttgatgacctcattgaggctcat
gaaggttggctgcctgcatgggttaataaacattaa

DBGET integrated database retrieval system