KEGG   Photobacterium profundum: PBPRB0304Help
Entry
PBPRB0304         CDS       T00173                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppr  Photobacterium profundum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PBPRB0304
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PBPRB0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(343636..344661)
Genome map
AA seq 341 aa AA seqDB search
MKWISLLLLSVPFFSQASLQTKAQGCDTRNDDKLWSFYKQKFVNQQGRVIDNGNESISHS
ESQGYGMLMAEFFNDHQSFKQIWHWTEGKLQRHNDALFSWKWQQKTPHIPDPNNASDGDI
FIAWALLKADKKWPGNEYDLDAKAIINELASSHIISIDKEYALLPARQGFQTPQYTVVNP
SYWVYPAFNDFAIQNNIWTDLNQSGRNILDKNQFGQYQLPSDWLEFGESHWRPATQFPAR
FSYSSYRIPLYLIWGGYDNSISDNYRNWLLDNNTAWLDVNSNEMANYGPPQGAHAIAALV
QLSQEKYKHRSALPHPSNQDDYYSASLILFSHIAFHERYCQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatatcactacttttactaagtgtaccgttcttttctcaagcctcgctacag
accaaagcccaaggctgtgatacccggaacgacgacaaattatggtcattctataagcaa
aaattcgtgaaccaacaaggccgggttatcgacaacggaaacgaaagcatcagccacagt
gaaagtcaaggctacgggatgctgatggcagaattcttcaatgaccaccagtcatttaag
cagatttggcattggactgaaggcaagctgcaacgacataacgacgcgctgttctcctgg
aaatggcaacagaaaacgccgcatatccctgatccaaacaatgccagcgatggtgatata
ttcattgcctgggctttgctcaaagcggataagaaatggcccggtaacgagtatgatctg
gacgcgaaggccatcatcaatgagctggccagcagccatattatttctatcgacaaagaa
tacgcactcttgcctgccagacaaggttttcagacgccacaatatactgtggtcaatccc
tcttattgggtttaccccgcatttaatgactttgctatccagaacaatatctggacagat
ctaaatcagagcggtcgcaacatactggataaaaaccagtttggtcagtatcagctaccc
tctgattggcttgagtttggcgaatcacactggcgccctgccacgcagtttccggctcgc
ttcagttactccagctatcgtatcccactttatttgatctggggcggttatgacaattcg
atcagtgacaattatcgaaattggctactggataacaatacagcctggctcgatgtgaat
agcaatgaaatggcgaactatggcccgccgcaaggtgcacatgcgattgccgcactggtt
cagctcagccaggaaaaatacaaacaccgtagtgcactgcctcaccccagcaaccaagac
gattactactctgccagcttgattttattttcacatattgcttttcatgagaggtattgc
caatga

DBGET integrated database retrieval system