KEGG   Photobacterium profundum: PBPRB0359Help
Entry
PBPRB0359         CDS       T00173                                 

Gene name
CSAP
Definition
(GenBank) hypothetical alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ppr  Photobacterium profundum
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PBPRB0359 (CSAP)
   00790 Folate biosynthesis
    PBPRB0359 (CSAP)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PBPRB0359 (CSAP)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PBPRB0359 (CSAP)
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PBPRB0359 (CSAP)
Exosome [BR:ppr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PBPRB0359 (CSAP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ppr00537]
 Enzymes
  PBPRB0359 (CSAP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:404646..405008
Genome map
AA seq 120 aa AA seqDB search
MTADHAHTMIMNGYAERGNPILGLSKTKGKYSEDEFGKRYTTISYGNGPGAVKEGRADVT
QQEATSVDYLQQSLIRLGSETHSGEDVTIFARGPKAWLFQGTVEQNYIFHVMNEALELTK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccgatcacgcacacaccatgatcatgaatggttacgcagagcgcggtaatcca
atcttgggtttgtctaaaacgaagggcaaatacagcgaagatgagtttggtaaaaggtac
acgactatctcgtatggtaatggtcctggtgcagtaaaagaggggcgtgctgacgtaact
caacaagaagcaactagcgttgattacttacagcaatctttgattcgtttaggatcagaa
acacattcaggtgaagacgttacaatctttgctcgtggtcctaaagcgtggttgttccaa
ggtactgtcgagcaaaactatatctttcatgttatgaatgaagcgcttgaattaacgaag
tga

DBGET integrated database retrieval system