KEGG   Photobacterium profundum: PBPRB0742Help
Entry
PBPRB0742         CDS       T00173                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ppr  Photobacterium profundum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ppr01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ppr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:869354..870493
Genome map
AA seq 379 aa AA seqDB search
MSTTKPPLLWLNVFIFSFSLAVAAIGTPLYAYFIGFDWTQVAMLVVAFSYCGLSITAGYH
RLWSHKTYEANAVMRFIFAIGGAFALQNSILHWSSDHRVHHRHVDNNDKDPYSAKMGFFY
SHIGWMLREYQASRYTDYSNCRDLQKDKIVMWQDKYYGILAIVTNFGFPLIFGVVHGDIW
GALLLVGVVRLVLSHHTTFFINSLAHVWGSQPYSDKNTARDNGILAYLTFGEGYHNYHHI
FENDYRNGIRWWQFDPTKWLIKSCSYFGFTRKLRVSPEDRIEKARAKMQLVRLQAKLTAT
SNANNCDVQARIRLLEEEYELLMSKISDYYAAKKRMVELKKKHLTKHYENFEFMQQYNDM
KLHLQEQRKSWKMLTAQYA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccactaaaccaccactactttggctgaatgtctttattttctcattctcactg
gctgtagctgccattggtacgccactttacgcatattttatcggtttcgattggacgcaa
gttgcaatgcttgttgttgcatttagctattgtggtttgtcaatcactgcgggctaccat
cgtttatggtcgcataaaacgtatgaagcaaatgctgtaatgcgttttatctttgcaatt
ggtggtgcctttgcgctgcaaaatagcatcttgcattggtcgtctgatcaccgagttcat
catcgccacgttgataataatgataaagatccgtattcagcgaaaatgggctttttctat
agccacattggttggatgttacgtgagtatcaagctagtcgttatactgattattcaaac
tgccgtgacttacaaaaagataaaattgtaatgtggcaagataagtattatggcatatta
gctatcgtgacaaatttcggtttcccattaatttttggtgttgtgcatggcgatatatgg
ggggcattattgctcgtcggcgtcgttcgtttagttctgagtcatcatacaacgttcttt
attaactcattggctcatgtatggggctctcagccgtattctgataagaacacagcgcgt
gataacggtattctagcgtatttaacatttggtgagggttaccataattaccatcacata
tttgaaaatgattatcgtaacggcattcgctggtggcagtttgatccgactaagtggttg
attaagtcgtgctcttattttggtttcactcgcaagttacgtgtttctcctgaagatcgt
atagagaaagcacgagcgaaaatgcaacttgttcgtttacaggctaagttaacagcaacg
tctaatgccaataattgtgatgttcaagcccgtattcgattactggaagaagaatacgaa
ttgttgatgagcaaaatttcagattactatgcagctaaaaaacgtatggttgaattaaag
aagaagcatttaaccaagcattatgaaaattttgaatttatgcagcaatacaacgatatg
aaactacatttacaagagcaacgaaaatcttggaaaatgttaacagcacaatatgcataa

DBGET integrated database retrieval system