KEGG   Photobacterium profundum: PBPRB0847Help
Entry
PBPRB0847         CDS       T00173                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ppr  Photobacterium profundum
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PBPRB0847
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PBPRB0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:979715..981619
Genome map
AA seq 634 aa AA seqDB search
MSDNKNNDLIEQPNQDTLPNKERRKFFGKTAAIGIGAAVAPMTAAMFASMAQAKAAEAAN
SPFVHPGDLDEYYGFWSGGHSGEVRIMGLPSMRELMRIPVFNIDSATGWGLTNESKRIKG
DSVDILAGDSHHPHMSMTDGRYNGKYVFINDKANSRVARIRCNVMKTDKMITIPNVQAIH
GLRVQKVPETKYVICNGEFEIPMNNDGKATLEDVSTYRSLFNVIDAEKMEVAFQVMVDGN
LDNTDADYDGKYFASTSYNSEMGMTLSEMITPERDHVVVFSLARCEAALKAGQFKTYNDN
NVPVLDGRKGSELTRYIPVPKSPHGLNTSSDGKYFVANGKLSPTVSIIAINKLDDLFSDK
IKPRDTIVAEPEVGLGPLHTAFDNRGNAYTTLFLDSQIAKWNVEDAIKAYNGEKVNYIRQ
KLDVHYQPGHNHTSQGETRDADGKWLVSLCKFSKDRFLPVGPLRPENDQLIDISGDEMKL
VHDGPTFAEPHDCIIVHRSKVKPQKLWTRDDPIFAETLAMAEKDGVDVMTQSKVIRDGNK
VRVYMTSIAPNFGLTEFKVKLGDEVTMIVTNLDMVEDVTHGFCMTNHGVQMEVGPQATSS
VTFIANKPGVQWYYCNWFCHALHMEMRGRMLVEA
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataataagaacaatgatctgatagagcaacctaaccaagatacattgccaaac
aaagaacgacgtaagttttttggtaaaactgccgctatcggtattggcgcggcagtcgcc
ccgatgacagctgcgatgtttgcttcaatggcacaagccaaggcagcagaagcggctaac
agcccgtttgttcatcctggcgatttagatgaatactatggtttctggagtggtggtcat
tccggtgaagtacgtattatgggtttgccatcaatgcgcgagttaatgcgcataccagta
tttaacattgatagtgcaaccggatggggtttaaccaacgaaagtaagcgtatcaaaggc
gacagtgttgatattttggcgggtgattcccaccaccctcatatgagtatgacggacggt
cgatacaatggtaaatatgtattcatcaacgacaaagccaacagtcgggttgctcgtatt
cgttgtaatgtcatgaaaaccgacaaaatgatcaccattccgaatgttcaggctattcac
ggattacgggtacaaaaagtacctgagactaaatacgtgatctgtaatggggaatttgaa
atcccgatgaataatgacggcaaggcgacactggaagatgtcagcacctaccgttctctg
tttaacgtgattgacgccgagaaaatggaagtggcatttcaggtaatggttgatggcaac
cttgataacactgatgccgactacgacggtaaatacttcgcgtcgaccagctacaactct
gaaatgggtatgacgctgagcgaaatgatcaccccagagcgagaccacgttgttgttttc
agtctagcgcgttgtgaagcggcgttaaaagcaggtcaattcaaaacttacaatgacaat
aatgttcctgttcttgatggccgtaaaggttctgaactcactcgttacattcctgtacca
aaatctccgcacgggctgaatacatcgtcagacggtaagtattttgtggctaacggcaag
ctatcgccaacagtttcgattattgcaatcaacaagcttgatgatctgttcagcgacaaa
atcaagccacgtgacactatcgttgcagagcctgaagtgggccttggtcctcttcatacc
gcttttgataaccgtggtaacgcctacacgacgttgttccttgatagtcagattgcaaaa
tggaatgtagaagatgcaatcaaagcttacaatggagagaaagtaaactatatccgtcaa
aagctagatgtgcattatcaacctggacacaaccatacctctcagggggaaactcgtgat
gctgatggtaaatggcttgtttctctctgtaagttctctaaagaccgattcttgcctgtt
ggtccactacgtcctgagaatgatcagttaattgatatctcaggcgatgagatgaagttg
gtgcatgacggcccgacgtttgcggaaccccatgactgtataattgttcaccgtagcaag
gtgaagccacagaaactctggacccgtgatgatccaatctttgcagaaacactggcaatg
gccgagaaagacggtgtcgatgtgatgactcaaagcaaagtgatccgtgatggcaacaag
gtgcgtgtttatatgacctcgattgcgccgaacttcgggctcactgaattcaaggtaaaa
ctgggcgatgaagtcaccatgatcgtcactaacctggacatggtggaagatgttactcac
ggcttctgtatgactaaccatggcgttcagatggaagttggtccacaggcaacgtcatct
gttacctttattgccaataaaccaggggttcagtggtattactgtaactggttctgtcac
gcactccacatggagatgcgaggccgtatgctggttgaggcctga

DBGET integrated database retrieval system