KEGG   Photobacterium profundum: PBPRB1112Help
Entry
PBPRB1112         CDS       T00173                                 

Gene name
PA3925
Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppr  Photobacterium profundum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBPRB1112 (PA3925)
   00630 Glyoxylate and dicarboxylate metabolism
    PBPRB1112 (PA3925)
   00640 Propanoate metabolism
    PBPRB1112 (PA3925)
   00650 Butanoate metabolism
    PBPRB1112 (PA3925)
  Lipid metabolism
   00071 Fatty acid degradation
    PBPRB1112 (PA3925)
   00072 Synthesis and degradation of ketone bodies
    PBPRB1112 (PA3925)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PBPRB1112 (PA3925)
   00310 Lysine degradation
    PBPRB1112 (PA3925)
   00380 Tryptophan metabolism
    PBPRB1112 (PA3925)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PBPRB1112 (PA3925)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PBPRB1112 (PA3925)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PBPRB1112 (PA3925)
Enzymes [BR:ppr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PBPRB1112 (PA3925)
Exosome [BR:ppr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PBPRB1112 (PA3925)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1258779..1260026)
Genome map
AA seq 415 aa AA seqDB search
MEKTIWIVSAKRTPLGSFQGKLKAFSAPQLGQFAIKAALDAVPISPDCINEVFMGCVLTA
GCGQAPARQAALGAGLSYSVGCTTINKVCGSGMKSVMLAHDLIKAGSIGCAVAGGMESMS
NAPYLLKESRNGMRIGHKTTYDHMFLDGLQDAYEGDLMGVYAQHIADRLNYTREQMDEWA
TMSVQRSLDAQTQQLFTDEIVPISLSTKGAAAPEDGTNTHNSKTLDYDEHPREVDLQKIP
KLTPVFAMHGTVTAANSSAISDGAAALVVMNAEIAQQQGLEPLAIIRGHTTHARKPAEFT
LAPVYAIEQLLSKLDWSIDEVDLWEINEAFAVVTQIAVRQLGLDIDKVNIKGGACALGHP
IGASGARILVTLIHSLRQIQALDTEHEPNKKVMRGVASLCIGGGEATAMGIEIPL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaccatttggattgtatctgcaaaacgtacaccgttaggtagctttcaaggc
aagcttaaagcgttttctgcccctcaattagggcaatttgccatcaaggctgcacttgat
gcggtgcctatttcacctgattgtatcaatgaagtttttatgggttgtgtattgactgcg
ggctgcggtcaagcgcctgctcgtcaagcggctttaggagcagggctgtcgtattctgtt
ggttgcacgacgattaataaagtctgcggttcagggatgaaatcagtcatgttagcgcat
gatttgattaaggctgggtcaataggttgtgctgttgctggtggtatggaaagcatgagc
aacgcaccatacctcctgaaggagtcacgcaatggtatgcggatcggtcataaaacaacg
tatgaccatatgtttctagatggcttacaagatgcgtatgaaggcgacttaatgggtgtg
tatgctcaacatattgccgataggttaaattacaccagagagcagatggatgaatgggcg
actatgtcggttcaacgctctttagatgcgcaaacacagcagttatttaccgatgaaata
gtgccaatttcgttatcaactaaaggtgcggcagcaccagaagacggtacgaatacacat
aacagtaagacgttagattacgatgaacaccctcgcgaagtagatctccaaaaaatcccc
aagctcactcctgtatttgcgatgcacggtactgtaacagcagcaaattcaagtgcgatt
tccgatggtgctgctgcattagtggtgatgaatgctgaaattgcgcagcaacaaggatta
gagcctcttgccattatcagggggcataccacacatgctcgtaagccagcagaattcaca
cttgcgcctgtttacgctattgaacaattgttatctaaattagattggtcgattgatgaa
gttgatttatgggaaatcaatgaagctttcgctgtggttacacaaatagcggtgcgccaa
ttaggtttagatattgataaggtaaatattaaaggaggcgcgtgtgcgcttgggcatccc
attggtgccagtggtgcacgtattctggttacgcttattcatagcctgaggcagattcaa
gcattagataccgaacatgaacctaataaaaaagtgatgcgcggcgttgcttcactttgt
attggagggggagaagcgacagcaatgggtatcgaaattccgctataa

DBGET integrated database retrieval system