KEGG   Photobacterium profundum: PBPRB1182Help
Entry
PBPRB1182         CDS       T00173                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppr  Photobacterium profundum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PBPRB1182
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PBPRB1182
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PBPRB1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1333317..1333871)
Genome map
AA seq 184 aa AA seqDB search
MALKSLAIVEAEWFFYPHIRVRMMMTTFYDISADNIRGESVSMNEFAGKLVLVVNTASEC
GFTPQYRGLQDLYAKYKDQGLVIIGFPCNQFGGQEPGENTDIAESCLINYGVDFPMFAKV
DVNGADSHALFQYLVKALPGTFGSKVKWNFTKFMISRDGKPLKRFAPTKKPESMEADIVR
ALKA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttggctctaaaatcacttgctatagtggaagcagaatggtttttttatccccatatacgt
gtgagaatgatgatgacgactttttatgacatatcagcagataatatacgtggtgaaagc
gtatcgatgaatgagtttgcaggcaagctcgtacttgtagtaaacacggcgagtgaatgt
ggttttacacctcaatatcgcggcctacaagatttgtatgcaaaatataaagaccaaggt
ttagtcattattggtttcccatgtaatcaatttggtgggcaagaacctggtgagaataca
gatatcgccgaatcatgtttaattaattatggtgtcgattttccaatgtttgcgaaagtt
gatgtaaatggtgcggatagccacgcgctatttcaatatttagtgaaagcattacctggt
acatttggctctaaggtgaaatggaattttactaaattcatgattagtcgtgatggtaaa
ccattaaagcgttttgctccgaccaagaaaccagaatcgatggaagctgatattgttcga
gcgttaaaggcataa

DBGET integrated database retrieval system