KEGG   Photobacterium profundum: PBPRB1182Help
Entry
PBPRB1182         CDS       T00173                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppr  Photobacterium profundum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1333317..1333871)
Genome map
AA seq 184 aa AA seqDB search
MALKSLAIVEAEWFFYPHIRVRMMMTTFYDISADNIRGESVSMNEFAGKLVLVVNTASEC
GFTPQYRGLQDLYAKYKDQGLVIIGFPCNQFGGQEPGENTDIAESCLINYGVDFPMFAKV
DVNGADSHALFQYLVKALPGTFGSKVKWNFTKFMISRDGKPLKRFAPTKKPESMEADIVR
ALKA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttggctctaaaatcacttgctatagtggaagcagaatggtttttttatccccatatacgt
gtgagaatgatgatgacgactttttatgacatatcagcagataatatacgtggtgaaagc
gtatcgatgaatgagtttgcaggcaagctcgtacttgtagtaaacacggcgagtgaatgt
ggttttacacctcaatatcgcggcctacaagatttgtatgcaaaatataaagaccaaggt
ttagtcattattggtttcccatgtaatcaatttggtgggcaagaacctggtgagaataca
gatatcgccgaatcatgtttaattaattatggtgtcgattttccaatgtttgcgaaagtt
gatgtaaatggtgcggatagccacgcgctatttcaatatttagtgaaagcattacctggt
acatttggctctaaggtgaaatggaattttactaaattcatgattagtcgtgatggtaaa
ccattaaagcgttttgctccgaccaagaaaccagaatcgatggaagctgatattgttcga
gcgttaaaggcataa

DBGET integrated database retrieval system