KEGG   Photobacterium profundum: PBPRB1931Help
Entry
PBPRB1931         CDS       T00173                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ppr  Photobacterium profundum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PBPRB1931
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PBPRB1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2123686..2124681)
Genome map
AA seq 331 aa AA seqDB search
MIQVCITELVTKESSFTTLMTHEIHQMWQQRQQDTFMGVNNIPIRWISITHQKNTQCVVI
VNGRNESFWKYQEVFYEFSRRGFDVFAFDHRGQGASGRITTDPEVGHVDSFNDYVEDLHQ
FVDGIVKPSHYKHAFILAHSMGGAITTLYLEQHPYVFDAAVLNAPMFGIRMPAILHRIAP
FMAKMLTKVAAKYQQQPSYLFGQKAYYEASFENNDQCQSLLRYVWAKHLYQVHPELRIGG
PSARWLWQALTAANDCIRDAEKLKTPVLLLQAGNDTIVDNKAQRRFNCVSEQCQIKVIEQ
ARHELLMEKDELRNQVLMETVSFFDRFTVIN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatccaagtatgcataacggaacttgtcacgaaggaatcgagctttaccacgctaatg
acacatgaaattcatcaaatgtggcaacaacggcagcaagatacatttatgggggtaaat
aatataccgatccgttggataagtattacccatcagaagaatacacagtgtgttgttatt
gttaatggtcgcaatgaaagtttttggaaataccaagaagtattctatgaatttagtcgt
cgtggttttgatgtgtttgcgtttgatcaccgtgggcaaggtgcttcagggcgtataacc
accgatcctgaagtcgggcatgttgatagttttaatgactatgttgaagacctacatcaa
tttgtagatggcatcgtaaagccaagtcattacaaacatgcattcattctggcgcattca
atgggtggtgcaataacaacgctatacctagaacaacacccttatgtattcgatgcagca
gtgttaaatgcccctatgtttggcattcgcatgcctgctattctacaccgtatcgcgcca
tttatggcgaagatgttgactaaagttgcagctaaatatcaacaacaaccttcttattta
tttggacagaaggcatattatgaagcctctttcgaaaataatgaccaatgccaaagtttg
ctacgttacgtatgggcgaagcatttatatcaggttcaccctgagctgcgcattggaggt
cctagtgctcgctggttgtggcaagctttaaccgcggcaaatgattgtattcgagatgcg
gaaaaattgaagacccctgttttgttattacaggcgggtaacgacacaatagtcgataat
aaagcgcagcgtcgtttcaattgcgtgagtgagcaatgccagatcaaagtgatagagcaa
gctaggcatgaactattgatggagaaagatgaactacgcaaccaagtactaatggaaact
gtctccttttttgaccgttttacagtgatcaattaa

DBGET integrated database retrieval system