KEGG   Photobacterium profundum: PBPRB2006Help
Entry
PBPRB2006         CDS       T00173                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ppr  Photobacterium profundum
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2210749..2212167)
Genome map
AA seq 472 aa AA seqDB search
MISPPDKSEFTTMKYQFPENFWWGSASSATQSEGAAFDGGKGDNIWDLWYQEQPNRFFNN
VSATKASTFYQNYQTDIALMKEIGHNTFRTSFSWSRLIPTGRGEVNQEAVAFYGKVIDEL
IANDIEPFICLFHFDMPVAMQELGGWESREVVEAYADFADVCFKLYGDRVKHWFTFNEPI
VPVEGGYLYDFHYPNVVDFKRAATVAFNTMLAHAEAVKRYRAQQLDGQIGIILNLTPSYP
RSQNTADVKAANIADLLFNRSFLDPSVKGEYPQELIAFLQEHDQMPACQEGDLATIAAGN
VDLLGVNYYQPRRIQAKLHTVNTDGPFLPEWFFDYYEMPGRKMNPHRGWEIYEQGVYDIL
TNLRENYGNIPCYISENGMGVEGEEKFIENGQVKDDYRIDFIKGHLTWLHKAVQEGANCK
GYHLWTFIDNWSWANAYKNRYGFYRLDLETQTRTVKRSGEWFAQASKANGFD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgatatcaccgcctgataaatcggaatttactactatgaaatatcaatttcctgaaaat
ttttggtggggcagtgcctcatcagcaacacaatctgaaggagcagcttttgacggtggc
aaaggggataatatttgggacctttggtatcaagagcaacctaaccgtttctttaataat
gtaagcgcgacaaaggcgtcaacgttttatcaaaattaccaaactgatatcgcgttaatg
aaagagattggtcacaacacatttcgtacatcgttctcttggtcacgattaataccaaca
ggtcgtggtgaagttaatcaagaagctgtggcattctatggcaaggtgattgacgagtta
attgcaaacgatatcgagccgtttatttgtttattccatttcgacatgcctgtcgcaatg
caagagcttggcggttgggaaagccgagaagtggttgaagcatacgctgattttgctgat
gtttgttttaagctttatggtgatcgcgtaaagcattggtttacgtttaatgaaccgatt
gtgccagttgaaggcgggtatctttatgatttccattaccctaatgtggtcgattttaaa
cgtgcagccactgttgcctttaatacgatgctagcccatgcagaagcagtaaagcgttac
cgcgctcagcaactcgatggtcaaattggtattattttaaatctgaccccgtcgtaccca
cgctcacaaaatactgccgatgtaaaagcggcaaatattgctgatttattgtttaatcgc
agcttcttagatccgtcggttaaaggtgagtatccgcaagagttaatagcctttctgcaa
gaacatgatcaaatgccagcctgtcaggaaggggatcttgccactatagcggcgggtaac
gttgatctacttggggtgaactattatcaaccgcgtcgtattcaagccaaattacataca
gtgaatacagacggtccatttctgcctgaatggttctttgattattacgaaatgccaggt
cgcaaaatgaacccacaccgtggctgggaaatttacgagcaaggcgtgtatgacatccta
actaaccttcgagaaaactacggcaatattccatgttatatctctgaaaatggtatgggg
gtcgagggtgaagagaaatttattgaaaacggccaagtaaaagatgattaccgtatcgac
tttattaaaggacatttaacctggctacataaagcagttcaagaaggggctaactgtaag
ggttaccatctttggacattcattgataactggtcgtgggcaaatgcttataaaaaccgt
tatggcttctaccgcctcgatcttgaaacacaaacacgcactgtaaagcgcagtggtgaa
tggtttgctcaagcgtctaaagcgaacgggtttgattaa

DBGET integrated database retrieval system