KEGG   Pseudomonas protegens CHA0: PFLCHA0_c00740Help
Entry
PFLCHA0_c00740    CDS       T02671                                 

Gene name
katE
Definition
catalase HPII (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PFLCHA0_c00740 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    PFLCHA0_c00740 (katE)
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PFLCHA0_c00740 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
71692..73830
Genome map
AA seq 712 aa AA seqDB search
MSTKKPDTPKSQMAGTDTLDRGNSNSKLKSLETFRSDATGQALRTNQGVKIADNQNTLKA
GARGPSLLEDFIMREKITHFDHERIPERIVHARGVGAHGYFQSYDNHSALTKAGFLRDPG
KKTPVFVRFSTVQGPRGSGDTVRDVRGFAVKFFTDEGNFDLVGNNMPVFFIQDAIKFPDF
VHAVKPEPHNEIPTGGSAHDTFWDFVSLQPESAHMVIWAMSDRAIPKSLRAMQGFGVHTF
RLINAQGRSSFVKFHWRPTVGTCSLVWDEAQKLAGKDTDFHRRDLWESIEAGDYPEWEFG
VQIIAEEDEHNFDFDILDPTKLIPEELVPITPLGKMVLNRNPDNYFAETEQVAFCPGHIV
PGIDFSNDPLLQGRLFSYTDTQISRLGGPNFHELPINRPLAPFHNSQRDAMHRITLDKGR
ASYEPNSIDGGWPRETPPAAEDGGFESYNERIDAHKIRQRSESFSDHFSQARLFYKSMSK
HEQEHIIAAYSFELGKVEREWIRERQVNEILANIDLQLAARVAENLGLAAPKKATVAERK
TSLSRSPALSQANLLPGNIKTRKVAILAANGVDGAAIDALKKALKAEGAHAKLLGPTSAP
VTTADGKSLPVDASMEGLPSVAFDAVFVPGGAQSIKALSGNGVALHYLLEAYKHLKAIAL
HGDARELLHSLRLEADEGLIVGADAKALKAFIAAIAQHRVWSREEKAKAIPA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaagaagcccgataccccaaaaagccagatggccgggaccgacaccctggac
cgcggcaacagcaacagcaagctcaagagcctggagacgttccgctccgacgccaccggg
caggccctgcggaccaaccagggggtgaagatcgccgacaaccagaacaccctcaaagcc
ggtgctcgtgggccttcgctgctggaagacttcatcatgcgggagaagatcacccacttc
gaccatgagcggattcccgagcgcatcgtgcatgcccgaggggtgggtgcccatggttac
ttccagagctatgacaaccattcggcattgaccaaggccggtttcctgcgtgatccgggg
aagaaaacaccagtgttcgtacgcttttccacggtccaggggccaagaggctctggcgac
accgtgcgtgatgtgcgcggctttgcggtgaagttcttcactgacgaaggcaacttcgac
ttggtgggcaacaacatgccggtgttcttcattcaggacgcgatcaagttccccgatttc
gtacacgccgtgaaacccgaaccccacaacgaaatacccaccggcggctcggcccatgac
accttctgggactttgtctcgctgcagccggaatcggcgcacatggtgatctgggccatg
tcagaccgggccattccgaaaagcctgcgggccatgcagggctttggcgtgcataccttt
cgcctgatcaacgcccagggccggtcgagcttcgtcaagttccactggcggccgacggtg
ggtacctgttcgctggtctgggatgaagcgcagaagctggcgggcaaggacaccgacttc
catcgccgcgacctgtgggaatcgatcgaagccggggattacccggagtgggagttcggc
gtacagatcatcgccgaggaagacgagcacaactttgatttcgacatcctcgacccgacc
aagctgatccccgaggagctggtgccgatcacgcccctgggcaagatggtgctgaaccgc
aacccggacaactattttgccgagaccgagcaggtcgccttctgcccggggcacatagtg
cccgggatcgacttctccaacgacccgctgttgcaagggcggctgttttcctacaccgat
acccagatcagccgcctgggtgggccgaacttccacgaattgccgatcaatcggccgctg
gcgcccttccacaacagccagcgcgacgccatgcaccgcatcaccctggacaagggccgg
gcctcctatgagcccaattccatcgacggcggctggccccgggaaaccccaccggcggcc
gaggatggcggcttcgagagttacaacgagcgtatcgatgcgcacaagatccgccagcgc
agcgaatcgttcagcgaccatttctcccaggcgcggctgttctacaagagcatgagcaag
cacgagcaggagcacatcatcgccgcctacagctttgagctgggcaaggtggaacgtgaa
tggatccgcgaacgccaggtcaacgagattctggccaacatcgacctgcaactggccgcg
cgagtggccgagaacctcgggctggcggcgccgaagaaagccacggtggcggagcgcaag
acttcgctctcgcgctcgccggccctgagccaggcgaacctgttgccgggcaatatcaaa
acccggaaggtggcgattctggcggccaacggcgtcgatggtgcagcgatcgatgcgctg
aaaaaggctctcaaggccgaaggggcacacgccaagctactggggccgacctcggcgccg
gtcaccacggcagacggcaagagcctgccggtggatgcgtccatggagggcttgccatcg
gtggccttcgatgcggtgttcgtgcccggaggtgcgcagtcgatcaaggccttgagcggc
aatggcgtggccctgcattacttgctggaggcgtacaagcacctcaaggcgattgccctg
cacggcgatgcccgggagctgttgcacagcctgcggctggaggcggatgaaggcttgatc
gtgggggccgatgccaaggcgctgaaggcattcattgccgccatcgcgcaacatcgggtc
tggagccgagaggaaaaggccaaggcaatcccggcctga

DBGET integrated database retrieval system