KEGG   Pseudomonas protegens CHA0: PFLCHA0_c02670Help
Entry
PFLCHA0_c02670    CDS       T02671                                 

Definition
fatty acid desaturase, family 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PFLCHA0_c02670
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PFLCHA0_c02670
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PFLCHA0_c02670
Lipid biosynthesis proteins [BR:pprc01004]
 Desaturase
  First
   PFLCHA0_c02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
309288..310196
Genome map
AA seq 302 aa AA seqDB search
MTAMNPHIDRTGQRERQLAWLTVATPAVGTVVALVLAWHQGIGWLEIGALASMYLLTALG
VEVGMHRFFSHHAFKAGPVITAFFGIAGSMAAQGPILFWAATHRQHHAFTDKEGDPHSPR
PLKAGFIGNIQGWWHAHLGWLFSLRKQNWSQFVPDLLRDRLIMQINQRYYLWIILGLLLP
SLACGLITRSWEGALSGLLWGGFVRIFLVDHATWCINSFAHRVGGRDHKTRDTSRNVFWL
AIPTVGGGWHNNHHAFPALAHAGLKPWQLDIGGLFIELLALCGLAWDVKRPGPTVAAEPS
ES
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacggccatgaatcctcatatcgaccgcaccggccagcgcgagcggcaattggcctgg
ctgacggtcgcaactccggcagtgggcaccgtggtggccctggtgctggcctggcatcag
ggcatcggctggctggaaatcggcgcgctggccagcatgtacctgttgaccgccctggga
gtggaagtgggcatgcaccggttcttttcccaccatgcgttcaaggccggcccggtgatc
accgcattcttcggcatcgccggttcgatggcggcgcagggcccgatcctgttctgggcg
gcgacccatcgccagcaccacgccttcaccgacaaggaaggcgacccgcattcgccgcgt
ccgctcaaggcgggttttatcggcaatatccagggctggtggcacgctcacctgggctgg
ctgttcagcctgcgcaagcagaactggagccagttcgtgccggacctgctgcgcgatcga
ctgatcatgcagatcaaccagcgctactacctgtggatcatcctcggcctgctgctgccc
agcctggcatgcgggctgataacccgcagctgggagggcgcgctcagcggcctgctgtgg
ggcggcttcgtgcggatcttcctggtggaccacgccacctggtgcatcaactcctttgcc
caccgggttggcggccgcgaccacaagacccgggataccagccgcaacgtgttctggctg
gcgattccgacggtagggggcggttggcacaacaaccaccatgccttcccggcgctggcc
catgccggcctgaaaccctggcagttggatattggcggcctgttcatcgagctgctcgcc
ctctgcggcctggcctgggatgtcaaacggcccggcccgaccgtggctgcagaaccttca
gaaagctga

DBGET integrated database retrieval system