KEGG   Pseudomonas protegens CHA0: PFLCHA0_c11220Help
Entry
PFLCHA0_c11220    CDS       T02671                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pprc  Pseudomonas protegens CHA0
Brite
Enzymes [BR:pprc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PFLCHA0_c11220 (dsbC)
Secretion system [BR:pprc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PFLCHA0_c11220 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263276..1264007
Genome map
AA seq 243 aa AA seqDB search
MRLTQIFAAASLALLSTFAMADDSAEKAIRKSLETLQLETPVESITASPMGGLYEVKLKG
SRVLYASADGQFVVQGYLFQLKDGKPVNLTEKTERLGISKLINGIPVAETVVYPAIGETK
THITVFTDTTCPYCHKLHAEVPELNKLGVEVRYVAFPRQGLGSPGDEQLQAVWCSADKKA
AMDKMVDGKEIKAAKCANPVSKQFALGQSIGVNGTPAIVLADGQVIPGYQPAPQIAKLAL
GAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgacccagatttttgccgccgcctccctggcgctgctcagcacttttgccatg
gccgatgacagtgccgagaaagccatccgcaagagcctcgagaccctgcagctcgaaacg
cctgtggaaagcattaccgccagccccatgggtggcctgtacgaagtcaagctcaagggc
agtcgtgtgctgtacgccagcgccgacggccagttcgtggtccagggctacctgttccag
ctcaaggatggcaagccggtcaacctcaccgaaaaaaccgagcgcctgggcatttccaag
ttgatcaacggcattccggtcgcggaaactgtggtctatccagccattggcgaaaccaag
acccacatcaccgtgttcaccgacaccacctgcccgtactgccacaagctgcacgccgaa
gtgcccgagctgaacaagctgggcgtggaggtgcgctacgtggcgttcccacgccagggc
ctgggctcgccgggtgacgaacagctgcaagcggtctggtgctcggcggacaagaaagcc
gcgatggacaagatggtcgacggcaaggaaatcaaggccgccaagtgcgccaacccggtg
tccaagcaattcgccctgggccagtcgatcggcgtcaacggcaccccggccatcgttctg
gctgatggccaggtgattcccggctaccagccggcaccgcagatcgccaaactggccctg
ggtgcgaaataa

DBGET integrated database retrieval system