KEGG   Pseudomonas protegens CHA0: PFLCHA0_c14200Help
Entry
PFLCHA0_c14200    CDS       T02671                                 

Definition
(GenBank) amine oxidase, flavin-containing
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00260  Glycine, serine and threonine metabolism
pprc00330  Arginine and proline metabolism
pprc00340  Histidine metabolism
pprc00350  Tyrosine metabolism
pprc00360  Phenylalanine metabolism
pprc00380  Tryptophan metabolism
pprc01100  Metabolic pathways
pprc01110  Biosynthesis of secondary metabolites
Module
pprc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFLCHA0_c14200
   00330 Arginine and proline metabolism
    PFLCHA0_c14200
   00340 Histidine metabolism
    PFLCHA0_c14200
   00350 Tyrosine metabolism
    PFLCHA0_c14200
   00360 Phenylalanine metabolism
    PFLCHA0_c14200
   00380 Tryptophan metabolism
    PFLCHA0_c14200
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     PFLCHA0_c14200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 Thi4 HI0933_like Pyr_redox FAD_oxidored GIDA Lycopene_cycl AlaDh_PNT_C ApbA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGL83210
UniProt: A0A2C9EHT5
Position
1581278..1582855
Genome map
AA seq 525 aa AA seqDB search
MPLTRRQLIARIAAVGGVQAASAVMGLFGASATAEAFEENYAALPTAALGKGASVVVIGA
GIGGLVSAYELSKAGFKVTLLEARDRVGGRNWTVRGGDRVEYSDGSTQVAQFGEGFYLNA
GAGRLPSHHQLMLGYCRELGVELEVLVNTSRNALVRPDLDQPALQIRQAVNDSRGHFSEL
LAKAVNRHALDQELTPADRSNLLSFLKTWGDLSDKLEYLGSARSGYKVWPGAGDQLAQKN
DPLPLQTLLNPALTTALMIDEYPEFSPTMFQPVGGMDRIPQAFARRLKGQLRLHSEVRSI
SNQADSAEVVYLDRRTGRTHNLKADYVISSLPLPLLAKVQNNFSAPVRQAIGAVQFGYAN
KVAWQSRRFWESQYQIYGGLSFINQEASGLWYPSGGFNQAEGVLVAAYNNGETARRFGEK
TLAQQIEISRQAVELLHPGHSQELRNPLVIAWSKIPYNFGPWISHEVAEPDYGLLNQPQG
RVYLTSDGLAHSGVGIWQEAAAGAARRVVRQLFQRAQGSSLQQTA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgccactgaccagaagacaattgatcgcccgtattgccgctgtcggcggggtccaggcg
gcgagtgcggtcatgggcctgttcggcgccagcgcaacggccgaagcgttcgaggaaaac
tacgcggcgctgcccacggcggcgctgggcaagggggccagcgtggtggtgatcggcgcc
gggatcggtggcctggtcagcgcctacgagttgagcaaggccgggttcaaggtgaccttg
ctggaagcccgggaccgggtcggcgggcgcaactggacggtgcgtggtggcgatcgggtg
gagtacagcgacggcagcacccaggtcgcgcaattcggggaggggttctacctcaatgcc
ggggccggccgtctgcccagccaccatcagttgatgctcggctactgccgcgagctgggg
gtggagctggaggtgctggtcaataccagccgcaacgccctggtgcgtccggaccttgac
cagccggcgttgcagatccgccaggcggtcaatgacagccgcgggcatttttccgagctg
ctggccaaggccgtcaatcgccatgccctggatcaggagctgacaccagccgatcgcagc
aacctgctgagtttcctgaaaacctggggtgatctttccgacaagctggagtacctgggt
tcggcccgctccggctacaaggtctggcccggcgccggcgaccagctggcgcagaagaat
gatccgctgccgttgcagaccctgctcaacccggcgctgaccacggcgttgatgatcgac
gaatacccggagttctcgcccaccatgttccagccggtggggggcatggaccgcattccc
caggcctttgcccggcgcctgaaaggccagttgcggctgcacagcgaggtgcgctccatc
agcaaccaggccgacagcgccgaagtggtctatctggaccggcgcaccggccgcacccac
aacctcaaggccgactacgtgatcagcagcctgcccctgccgctgctggccaaggtgcag
aacaacttcagcgccccggtgcgccaggccatcggcgcggtgcagttcggctacgccaac
aaggtggcctggcagtcgcggcgcttctgggaaagccagtaccagatctacggcgggctg
tcgttcatcaaccaggaagcctccgggctgtggtaccccagcggcggtttcaaccaggcc
gaaggggtgctggtggcggcctacaacaacggcgaaaccgcccgacggttcggggagaaa
accctggcccagcagatcgagatttcccgtcaggcggtggagctcctgcaccccgggcac
agccaggaactgcgcaatccgctggtgattgcctggagcaagatcccctacaacttcggc
ccctggatcagccatgaagtggccgagccggactacggcctgctcaaccagccccagggc
cgggtctacctcaccagcgacggcctggcccacagcggcgtgggcatctggcaggaagcc
gccgccggcgcggcgcggcgggtggtgcggcaacttttccaacgggcgcaaggctcgtcg
ctacagcaaacggcctga

DBGET integrated database retrieval system