KEGG   Pseudomonas protegens CHA0: PFLCHA0_c14200Help
Entry
PFLCHA0_c14200    CDS       T02671                                 

Definition
amine oxidase, flavin-containing
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFLCHA0_c14200
   00330 Arginine and proline metabolism
    PFLCHA0_c14200
   00340 Histidine metabolism
    PFLCHA0_c14200
   00350 Tyrosine metabolism
    PFLCHA0_c14200
   00360 Phenylalanine metabolism
    PFLCHA0_c14200
   00380 Tryptophan metabolism
    PFLCHA0_c14200
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     PFLCHA0_c14200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581278..1582855
Genome map
AA seq 525 aa AA seqDB search
MPLTRRQLIARIAAVGGVQAASAVMGLFGASATAEAFEENYAALPTAALGKGASVVVIGA
GIGGLVSAYELSKAGFKVTLLEARDRVGGRNWTVRGGDRVEYSDGSTQVAQFGEGFYLNA
GAGRLPSHHQLMLGYCRELGVELEVLVNTSRNALVRPDLDQPALQIRQAVNDSRGHFSEL
LAKAVNRHALDQELTPADRSNLLSFLKTWGDLSDKLEYLGSARSGYKVWPGAGDQLAQKN
DPLPLQTLLNPALTTALMIDEYPEFSPTMFQPVGGMDRIPQAFARRLKGQLRLHSEVRSI
SNQADSAEVVYLDRRTGRTHNLKADYVISSLPLPLLAKVQNNFSAPVRQAIGAVQFGYAN
KVAWQSRRFWESQYQIYGGLSFINQEASGLWYPSGGFNQAEGVLVAAYNNGETARRFGEK
TLAQQIEISRQAVELLHPGHSQELRNPLVIAWSKIPYNFGPWISHEVAEPDYGLLNQPQG
RVYLTSDGLAHSGVGIWQEAAAGAARRVVRQLFQRAQGSSLQQTA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgccactgaccagaagacaattgatcgcccgtattgccgctgtcggcggggtccaggcg
gcgagtgcggtcatgggcctgttcggcgccagcgcaacggccgaagcgttcgaggaaaac
tacgcggcgctgcccacggcggcgctgggcaagggggccagcgtggtggtgatcggcgcc
gggatcggtggcctggtcagcgcctacgagttgagcaaggccgggttcaaggtgaccttg
ctggaagcccgggaccgggtcggcgggcgcaactggacggtgcgtggtggcgatcgggtg
gagtacagcgacggcagcacccaggtcgcgcaattcggggaggggttctacctcaatgcc
ggggccggccgtctgcccagccaccatcagttgatgctcggctactgccgcgagctgggg
gtggagctggaggtgctggtcaataccagccgcaacgccctggtgcgtccggaccttgac
cagccggcgttgcagatccgccaggcggtcaatgacagccgcgggcatttttccgagctg
ctggccaaggccgtcaatcgccatgccctggatcaggagctgacaccagccgatcgcagc
aacctgctgagtttcctgaaaacctggggtgatctttccgacaagctggagtacctgggt
tcggcccgctccggctacaaggtctggcccggcgccggcgaccagctggcgcagaagaat
gatccgctgccgttgcagaccctgctcaacccggcgctgaccacggcgttgatgatcgac
gaatacccggagttctcgcccaccatgttccagccggtggggggcatggaccgcattccc
caggcctttgcccggcgcctgaaaggccagttgcggctgcacagcgaggtgcgctccatc
agcaaccaggccgacagcgccgaagtggtctatctggaccggcgcaccggccgcacccac
aacctcaaggccgactacgtgatcagcagcctgcccctgccgctgctggccaaggtgcag
aacaacttcagcgccccggtgcgccaggccatcggcgcggtgcagttcggctacgccaac
aaggtggcctggcagtcgcggcgcttctgggaaagccagtaccagatctacggcgggctg
tcgttcatcaaccaggaagcctccgggctgtggtaccccagcggcggtttcaaccaggcc
gaaggggtgctggtggcggcctacaacaacggcgaaaccgcccgacggttcggggagaaa
accctggcccagcagatcgagatttcccgtcaggcggtggagctcctgcaccccgggcac
agccaggaactgcgcaatccgctggtgattgcctggagcaagatcccctacaacttcggc
ccctggatcagccatgaagtggccgagccggactacggcctgctcaaccagccccagggc
cgggtctacctcaccagcgacggcctggcccacagcggcgtgggcatctggcaggaagcc
gccgccggcgcggcgcggcgggtggtgcggcaacttttccaacgggcgcaaggctcgtcg
ctacagcaaacggcctga

DBGET integrated database retrieval system