KEGG   Pseudomonas protegens CHA0: PFLCHA0_c14320Help
Entry
PFLCHA0_c14320    CDS       T02671                                 

Definition
putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pprc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1594620..1595402)
Genome map
AA seq 260 aa AA seqDB search
MAKTLALPKDQLVKQALTQMQNTLADNTWTDRQKLALTCRILFENGHDSGLAGQITARGP
QPGTYYTQQLGLGFDEISASNLLLVNEDLEVLEGHGMPNPANRFHSWVYRARPDVNCIIH
THPTHVAALSMIEVPLAVSHMDLCPLYEDCAFLEAWPGVPVGNEEGEIISAALGDKRAIL
LSHHGQLSTGASIEEACVIAQLIERAAKLQLLAMAAGTIKPILPELGREAHDWISKPKRH
SAAFNYYARQNLKKHADCLN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacattagcattgcccaaagaccaactggtcaagcaagccctgacccagatg
caaaataccctggcggataatacgtggaccgaccgacaaaagctggccctgacctgccgc
attctgttcgagaacggccacgactcgggcctcgccgggcagatcaccgcccgcggcccg
caaccgggcacctactacacccagcaactgggcctgggcttcgatgaaatcagcgccagc
aacctgctgctggtcaacgaagacctggaggtcctcgaaggccacggcatgcccaacccg
gccaaccgcttccacagctgggtataccgcgcccggccggacgtgaactgcatcatccac
acccacccgacccacgtcgccgcgctgtcgatgatcgaagtgccgcttgcggtgtcgcac
atggacctctgtccactgtacgaggactgcgcctttctcgaagcctggccgggggtgcca
gtgggcaacgaagaaggcgaaatcatctccgccgccctgggcgacaagcgcgcgatcctg
ctttcccaccacggccagctgtccaccggcgcgagcatcgaggaagcctgcgtgatcgct
caactgatcgagcgtgcggccaagctgcaactgctggccatggccgccggcaccatcaag
ccgatcctcccggagctgggccgcgaagcccacgactggatttccaagcccaagcgccac
agcgccgccttcaactactacgctcggcaaaacctgaaaaaacacgccgactgcctgaac
tga

DBGET integrated database retrieval system