KEGG   Pseudomonas protegens CHA0: PFLCHA0_c14320Help
Entry
PFLCHA0_c14320    CDS       T02671                                 

Definition
putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PFLCHA0_c14320
Enzymes [BR:pprc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PFLCHA0_c14320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1594620..1595402)
Genome map
AA seq 260 aa AA seqDB search
MAKTLALPKDQLVKQALTQMQNTLADNTWTDRQKLALTCRILFENGHDSGLAGQITARGP
QPGTYYTQQLGLGFDEISASNLLLVNEDLEVLEGHGMPNPANRFHSWVYRARPDVNCIIH
THPTHVAALSMIEVPLAVSHMDLCPLYEDCAFLEAWPGVPVGNEEGEIISAALGDKRAIL
LSHHGQLSTGASIEEACVIAQLIERAAKLQLLAMAAGTIKPILPELGREAHDWISKPKRH
SAAFNYYARQNLKKHADCLN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacattagcattgcccaaagaccaactggtcaagcaagccctgacccagatg
caaaataccctggcggataatacgtggaccgaccgacaaaagctggccctgacctgccgc
attctgttcgagaacggccacgactcgggcctcgccgggcagatcaccgcccgcggcccg
caaccgggcacctactacacccagcaactgggcctgggcttcgatgaaatcagcgccagc
aacctgctgctggtcaacgaagacctggaggtcctcgaaggccacggcatgcccaacccg
gccaaccgcttccacagctgggtataccgcgcccggccggacgtgaactgcatcatccac
acccacccgacccacgtcgccgcgctgtcgatgatcgaagtgccgcttgcggtgtcgcac
atggacctctgtccactgtacgaggactgcgcctttctcgaagcctggccgggggtgcca
gtgggcaacgaagaaggcgaaatcatctccgccgccctgggcgacaagcgcgcgatcctg
ctttcccaccacggccagctgtccaccggcgcgagcatcgaggaagcctgcgtgatcgct
caactgatcgagcgtgcggccaagctgcaactgctggccatggccgccggcaccatcaag
ccgatcctcccggagctgggccgcgaagcccacgactggatttccaagcccaagcgccac
agcgccgccttcaactactacgctcggcaaaacctgaaaaaacacgccgactgcctgaac
tga

DBGET integrated database retrieval system