KEGG   Pseudomonas protegens CHA0: PFLCHA0_c21510Help
Entry
PFLCHA0_c21510    CDS       T02671                                 

Gene name
rbsK
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFLCHA0_c21510 (rbsK)
Enzymes [BR:pprc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PFLCHA0_c21510 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2368105..2369022
Genome map
AA seq 305 aa AA seqDB search
MSAKVVVVGSLNMDLVTRAERLPRGGETLIGKSFATVSGGKGANQAVAAARLGAQVSMVG
CVGDDAYGEQLRGALLAEQIDCQAVSVVEGSSGVALIVVDDSSQNAIVIVAGGNGQLTPE
KVAGFDGVLQDGQVIICQLEVPLATVGYTLKRGRELGKTVILNPAPASGPLPAQWYGAID
YLIPNESEASALSGVAVDSLESAEVAASRLIAAGAGKVIITLGAQGSLFADGQRFEHFPA
PRVKAIDTTAAGDTFVGGFAAALAAGKSEAEAIRFGQVAAALSVTRAGAQPSIPTLSDVQ
AFIPS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaagtagtggtagtgggtagcctcaacatggacctggtgactcgggccgag
cgcctgccccgagggggcgagacgctgattggcaaatccttcgccacggtatccggtggc
aagggcgccaatcaggcggtggctgcggccaggctgggagcgcaggtgtcgatggtcggc
tgtgtcggcgacgatgcctatggcgagcaactgcgaggtgccttgctggccgagcagatc
gattgccaggcggtgagtgtggtcgaaggctccagtggggtggcgctgatcgtggtggat
gacagtagccagaatgcgattgtcatagtcgccggcggcaatggccagctcactcccgag
aaggtcgccgggttcgatggggtgctgcaggatgggcaagtcatcatctgccagcttgaa
gtgccgctggcgactgtgggctacaccctcaagcgcgggcgcgaactgggcaagacggtg
atcctcaatccggcgccggccagtggcccgctgccagcgcagtggtatggcgcgatcgac
tacctgattcccaacgagagcgaggcttcggccttgagcggggtagcggtggactccctg
gagagcgctgaagtggctgccagtcgcttgatcgctgcgggtgctggcaaggtgatcatc
accctcggtgcacagggctcgctgtttgccgatggccagcgtttcgagcatttcccggcg
cccagggtcaaggcaatcgataccacggcggccggggacacctttgtcggcggatttgcc
gcggccctggctgccggcaagagcgaagccgaggccatccgctttggccaggtggctgcg
gcgctgtcggtgacgcgcgccggtgcgcaaccttccattcccacgctgtccgacgttcag
gcgtttatcccttcatga

DBGET integrated database retrieval system