KEGG   Pseudomonas protegens CHA0: PFLCHA0_c27990Help
Entry
PFLCHA0_c27990    CDS       T02671                                 

Definition
hypothetical protein
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PFLCHA0_c27990
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFLCHA0_c27990
   00330 Arginine and proline metabolism
    PFLCHA0_c27990
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PFLCHA0_c27990
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     PFLCHA0_c27990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3070001..3074995
Genome map
AA seq 1664 aa AA seqDB search
MRLVQLHPPVILLPLPETRSRMQHRPARGLHATLPSITSPSGVPQMAFFTAASKADFQHQ
LQAALAQHISEQALPQVALFAEQFFGIISLDELTQRRMSDLAGCTLSAWRLLERFDHGQP
QVRVYNPDYERHGWQSTHTAVEVLHHDLPFLVDSVRTELNRRGYSIHTLQTTVLSVRRGS
KGELLEILPKGTQGEGIQQESLMYLEIDRCANAAELSVLGKELEQVLGEVRVAVADFEPM
KAKVQELIQSIDNSQFPIAAEEKTEIKSFLEWLVGNHFTFLGYEEFVVGADQDGGHIEYD
PSSFLGLAKLLRAGLTSDDLRIEDYAVNYLREPTPLSFAKAAHPSRVHRPAYPDFVSIRQ
IDADGKVIKECRFMGLYTSSVYGESVRVIPYIRRKVEAIEQRSGFQAKAHLGKELAQVLE
VLPRDDLFQTPVDELFSTVMSIVQIQERNKIRVFLRKDPYGRFCYCLAYVPRDIYSTEVR
QKIQQVLMDRLQATDCEFWTFFSESVLARVQLILRVDPKQRIDIDPLLLEKEVVQACRSW
QDDYASLVVESFGEAHGTNVLADFPKGFPAGYRERFAAHSAVVDMQHLLSLTEANPLVMS
FYQPLGQVSGQRELHCKLYHADTPLALSDVLPILENLGLRVLGEFPYRLRHNNGREFWIH
DFAFTAAEGLDLDIQQLNDTLQDAFVHIVRGDAENDAFNRLVLTAGLPWRDVALLRAYAR
YLKQIRLGFDLGYIASTLNNHTDIARELTRLFKTRFYLARKLTSDDLEDKQQRLEQAILT
ALDDVQVLNEDRILRRYLDLIKATLRTNFYQTDANGQNKSYFSFKFNPHAIPELPKPVPK
FEIFVYSPRVEGVHLRFGNVARGGLRWSDREEDFRTEVLGLVKAQQVKNSVIVPVGAKGG
FLPRRLPLGGSRDEIAAEGIACYRIFISGLLDITDNLKDGALVPPANVVRHDDDDPYLVV
AADKGTATFSDIANGIAIDYGFWLGDAFASGGSAGYDHKKMGITAKGAWVGVQRHFRERG
INVQEDSITVVGVGDMAGDVFGNGLLMSDKLQLVAAFNHLHIFIDPNPDPATSFVERQRM
FALPRSAWSDYDTSIMSEGGGIFSRSAKSIAISPQMKERFDIQADKLTPTELLNALLKAP
VDLLWNGGIGTYVKASTESHADVGDKANDALRVNGNELRCKVVGEGGNLGMTQLGRVEFG
LNGGGSNTDFIDNAGGVDCSDHEVNIKILLNEVVQAGDMTDKQRNQLLASMTDEVGGLVL
GNNYKQTQALSLAARRAYERAAEYKRLMSDLEGRGKLDRAIEYLPTEEQLTERAATGKGL
TRPELSVLISYSKIDLKEALLKSLVPDDDYLTRDMETAFPPSLVAKFSEAMRRHRLKREI
VSTQIANDLVNHMGITFVQRLKESTGMSPANVAGAYVIVRDIFHLPHWFRQIEALDHQVS
AEVQLALMDELMRLGRRATRWFLRSRRNEQDAARDVAHFGPHLAALGLKLDELLEGPTRE
GWQARYTAYVEAGVPELLARMVAGTTHLYTLLPIIEAADVTGHDAAEVAKAYFAVGSALD
LPWYLQQISDLPVANNWQAAAREAFRDDVDWQQRAITIKVLQMADAPDDMEARVALWLEQ
NASMADRWRAMMVEIRAASGTDYAMYAVANRELLDLAMSGQSVL
NT seq 4995 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtctcgtccagcttcacccacctgtcatcctgctacctctgcccgagaccaggagc
aggatgcagcaccgccccgcgaggggtttgcacgcgacgcttccatcaataacaagccca
agcggagtaccacagatggcgttcttcaccgcagccagcaaagccgacttccagcaccaa
ctgcaagcggcactggcgcagcacatcagtgaacaggcactgccacaagtggcgctgttc
gctgaacaattcttcggcatcatttccctggacgaactcacccagcgtcgcatgtccgac
ctggcgggctgcaccctttctgcctggcgcctgcttgagcgcttcgaccacgggcaaccg
caggtccgcgtctacaaccccgattacgaacgccatggctggcagtcgacccacactgct
gtggaagtcctgcaccacgacctgccgtttttggtggactcggtacgcaccgagctcaac
cgtcgcggctacagcatccacaccctgcagaccaccgtgctcagcgtacgtcgtggcagc
aagggcgagctgctggaaatcctgcccaagggcacccagggcgaaggcatccagcaagag
tcgctgatgtacctggagatcgaccgttgcgccaatgccgccgaactcagcgtgctgggc
aaggagttggaacaggtactgggcgaagtgcgggtcgccgtggccgacttcgagccgatg
aaggccaaggtccaggaactgatccagagcatcgacaacagccagttcccgatcgccgcc
gaagaaaagaccgagatcaagagcttcctcgaatggctggtgggcaaccacttcaccttc
ctcggttatgaagaattcgtggtcggcgccgaccaggacggcgggcatatcgaatatgac
ccgagctccttcctcggtctggccaagctgctgcgcgccggcctcaccagcgatgacctg
cgcatcgaagactacgccgtcaactacctgcgcgaaccgacgccgctgtccttcgccaag
gccgcgcacccgagccgtgtgcaccgtccggcctacccggatttcgtctcgatccgccag
atcgatgccgacggcaaggtcatcaaggaatgccgcttcatgggcctgtacacctcttcg
gtgtacggcgagagcgtgcgggtgatcccttacatccgccgcaaggtcgaagccatcgag
cagcgctcgggcttccaggccaaggcgcacctgggcaaggaactggcccaggtgctggag
gtactgcctcgcgatgatctgttccagaccccggtggacgagctgttcagcaccgtgatg
tccatcgtgcagatccaggaacgcaacaagatccgcgtgttcctgcgcaaagacccgtac
ggccgcttctgctactgcctggcctacgtgccgcgcgacatctattccaccgaagtgcgg
cagaagatccagcaagtgctgatggatcgcctgcaagccaccgactgcgagttctggacc
ttcttctccgagtcggtactggcccgcgtgcagttgatcctgcgggtggacccgaagcag
cgcatcgacatcgatccgctgctgctggaaaaagaagtggtgcaggcctgccgcagctgg
caggacgactacgccagcctggtggtggaaagcttcggcgaagcccacggcaccaacgtg
ctggcggacttccccaaaggcttcccggccggctaccgcgagcgcttcgctgcccattcg
gcggtggtggacatgcagcacctgctgagcctcaccgaagccaacccgctggtgatgagc
ttctaccagcccctgggccaggtctccggccagcgcgagctgcactgcaagctgtaccac
gccgacaccccgctggcgctgtccgacgtgctgccgatcctggaaaacctcggcctgcgc
gtgctgggcgaattcccgtaccgcctgcgtcacaacaatggccgtgagttctggatccac
gacttcgccttcaccgccgccgaaggcctggacctggatatccagcagctcaacgacacg
ctgcaggacgccttcgtccatatcgtgcgtggcgatgccgagaacgatgccttcaaccgc
ctggtgctgaccgccggcctgccatggcgcgacgtggcgctgctgcgtgcctacgcccgc
tacctgaagcagatccgcctgggcttcgacctgggctacatcgccagcaccctgaacaac
cacaccgacatcgcccgcgagttgacccggttgttcaagacccgcttctacctggcgcgc
aagctcaccagcgacgacctggaagacaagcagcagcgtctggagcaggcgatcctcacc
gccctggacgacgtacaggtgctcaacgaagaccgcatcctgcggcgctacctggacctg
atcaaggccaccctgcgcaccaacttctaccagaccgacgccaacggccagaacaagtcg
tacttcagcttcaagttcaacccgcacgcgatcccagagctgccgaaaccggtgcccaag
ttcgaaatcttcgtctactcgccgcgtgtcgaaggcgtgcacctgcgcttcggcaacgtt
gcccgtggcggcctgcgctggtccgaccgtgaagaagacttccgcaccgaagtcctgggc
ctggtcaaagctcagcaagtgaagaactcggtgatcgtgccggtgggcgccaagggcggc
ttcctgccccgtcgcctgccactgggcggcagccgggacgagatcgcggccgagggcatc
gcctgctaccgcatcttcatctccggcctgctggacatcaccgacaacctgaaggacggc
gccctggtgccgccggccaacgtcgtgcgccatgacgacgatgacccctacctggtggtc
gcggcggacaagggcactgcgaccttctccgacatcgccaacggcattgccatcgactac
ggcttctggctgggtgacgccttcgcctccggtggttcggccggttacgaccacaagaag
atgggcatcaccgccaagggcgcgtgggttggcgtgcagcgccacttccgcgagcgcggc
atcaatgtccaggaagacagcatcaccgtggtcggcgtcggcgacatggccggcgacgtg
ttcggcaacggcttgctgatgtccgacaagctgcaactggtggcggcgttcaaccacctg
cacatcttcatcgacccgaacccggatccggccaccagcttcgtcgagcgccagcgcatg
ttcgcgctgccgcgttcggcctggagcgactacgacaccagcatcatgtccgaaggcggc
ggtatcttctcgcgtagcgccaagagcatcgccatctcgccgcagatgaaagagcgcttc
gacatccaggccgacaagctgaccccgaccgagctgctcaacgccttgctcaaggcgccg
gtggacctgctgtggaacggtggtatcggcacctacgtcaaggccagcaccgagagccac
gccgatgtcggcgacaaggccaacgacgccctgcgcgtcaacggtaacgagctgcgctgc
aaggtggtgggcgagggcggcaacctgggcatgacccagctgggtcgtgtggagttcggc
ctcaatggcggcggttccaacaccgacttcatcgacaacgccggtggcgtggactgctcc
gaccacgaagtgaacatcaagatcctgctcaacgaagtggtgcaggccggtgacatgacc
gacaagcagcgcaaccagctgctggcgagcatgaccgacgaagtcggcggcctggtgctg
ggcaacaactacaagcagacccaggccctgtccctggctgcgcgccgtgcctacgagcgt
gccgccgagtacaagcgcctgatgagcgacctggaaggccgtggcaagctggaccgcgcc
atcgagtacctgccgaccgaggagcagctcaccgagcgcgccgccaccggcaagggcctg
acccgtccggaactgtcggtgctgatttcctacagcaagatcgacctcaaggaagccctg
ctcaagtccctggtaccggatgacgactacctgacccgtgacatggagaccgcgttcccg
ccaagcctggtggccaagttctccgaggccatgcgtcgccatcgtctcaagcgcgagatc
gtcagcacccagatcgccaacgacctggtcaaccacatgggcatcaccttcgtgcagcgc
ctgaaggagtccaccggcatgagcccggcgaacgtcgccggtgcctatgtgatcgtgcgg
gacatcttccacctcccgcactggttccgtcagatcgaagccctggaccaccaggtttcg
gctgaagtgcaactggcgttgatggacgagctgatgcgcctgggccgtcgtgccacccgc
tggttcctgcgcagccggcgcaacgagcaggatgcggcgcgtgacgttgcgcacttcggt
ccgcacctggcggcgctgggcctgaagctcgacgagctgctcgaaggcccgacccgcgag
ggctggcaagcccgttacaccgcctatgtcgaagccggtgtgccggagttgctggcgcgc
atggttgcaggcactacccacctgtacaccctgctgccgatcatcgaggccgctgatgtg
accggacacgatgcggcggaagtggccaaggcctacttcgccgtcggcagtgccctcgac
ctgccgtggtacctgcagcagatcagcgatctgccggtggccaacaactggcaggcggcg
gcgcgcgaagccttccgcgatgacgtggactggcagcagcgggcgatcaccatcaaggtc
ctgcagatggccgatgcgccggatgacatggaggcccgtgtggctctgtggctggagcag
aacgcgagcatggccgatcgctggcgcgccatgatggtggaaatccgtgccgccagcggc
accgactacgccatgtatgcggtggccaaccgcgagttgctggacctggccatgagcggt
cagtcggtgctgtaa

DBGET integrated database retrieval system