KEGG   Pseudomonas protegens CHA0: PFLCHA0_c29200Help
Entry
PFLCHA0_c29200    CDS       T02671                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFLCHA0_c29200 (glgB)
Enzymes [BR:pprc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PFLCHA0_c29200 (glgB)
Exosome [BR:pprc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFLCHA0_c29200 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3233120..3235351
Genome map
AA seq 743 aa AA seqDB search
MSFSNKEQGKQQPALLPSAKAIDALVRAEHRDPFAILGPHGDGAGGQFIRAFLPGALSVQ
VLDRDQQQVLGSLQAGEVPGLFVGHFPEARPYLLRIQWAGGEQVSEDPYSFGPLLGEMDL
YLFAEGNHRDLSSCLGAQLTTVDGIDGVRFAVWAPNARRVSVVGDFNIWDGRRHPMRLRH
PSGVWELFIPRLQAGEAYKYEILGPQGILPLKADPMALATQLPPDTASRVAPPLTIDWQD
QEWMLARGERQRVDAPLSIYELHAGSWQCEVDDLGEVARQYSWTELAERLIPYVKDLGFT
HIELMPIMEHPFGGSWGYQPLSQFAPSARYGSPQDFAAFVDAFHQAGIGVILDWVPAHFP
TDTHGLAQFDGTALYEYGNPLEGFHQDWDTLIYNLGRTEVHGFMLASALHWLKHFHVDGL
RVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFLRHLNDVVALEAPGALVIAEESTA
WPGVSQRTDQGGLGFAYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFILP
ISHDEVVHGKHSLIDKMPGDRWQKFANLRAYLSFMWAHPGKKLLFMGCEFGQWREWNHDQ
QLDWYLLQYPEHRGVQQLVGDLNRLYRQYPALHDQDDVPQGFQWLIGDDAINSVYAWLRW
SKSGEPLLVVANFTPVPRQGYRVGVPVAGRWSELLNSDSQLYAGSNYGNGGEAFSEEQSS
HGQALSLVLNLPPLAVLILRPDS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctcgaacaaggaacagggaaagcagcaaccggcattgcttccttcggccaag
gccatcgacgccctggtacgggccgaacaccgcgatccattcgccattctcgggccccac
ggcgatggcgccggcgggcaattcatccgcgctttcctgcccggggcgctgagtgtgcag
gtactggaccgcgaccagcagcaggtgctcggcagcctgcaagccggtgaggtgccgggg
ctgtttgtcgggcactttcccgaggcccggccctatctcttgcgcattcaatgggccggg
ggcgaacaggtcagtgaagacccctacagcttcggccccctgctgggggagatggacctg
tacctgtttgccgaaggcaatcaccgcgacctcagttcctgcctgggggcgcaactgacc
accgtggacggcatcgacggcgtgcgttttgcggtctgggcaccgaatgcccggcgggtc
tcggtggtgggcgacttcaatatctgggacgggcgccggcacccgatgcgcctgcgccat
ccctccggggtctgggagctgttcatcccgcgcctgcaggcgggcgaggcctacaaatac
gagatcctcgggccccagggcatcctgccgctcaaggccgaccccatggccctggccacg
cagttgccgccggacaccgcctccagagtcgcgccgcccctgaccatcgactggcaggac
caggagtggatgctggcccgtggcgagcgccagcgggtggacgcgccgctgtcgatctat
gagctgcatgccggttcctggcagtgcgaagtggacgaccttggagaagtggcccgccag
tacagctggaccgaactggccgaacggctgattccctacgtcaaggacctggggtttacc
catatcgagctgatgccgatcatggagcacccgtttggcggctcctggggctaccagccg
ctgtcgcagttcgcccccagcgcccgctacggtagcccgcaggatttcgcagccttcgtc
gacgccttccaccaggcgggcatcggggtgattctcgattgggtgccggcgcactttccc
accgatacccacggcctggcgcagttcgacggcactgcactgtatgagtacggcaacccc
ctggaaggcttccaccaggactgggacaccctgatctacaacctggggcgtaccgaagtg
cacggtttcatgctggcttcggcgctgcactggctcaagcatttccacgtcgacggcctg
cgggtggatgccgtggcctcgatgctctaccgcgactattcgcgcaaggctggggaatgg
gtgccgaaccgccacggcggccgggaaaacctcgaagccattgattttctgcgccacctc
aacgacgtcgtggccctggaggccccgggtgccctggtgatcgccgaggagtccaccgcc
tggcctggggtcagccagcgcaccgatcagggcggcctgggctttgcctataaatggaac
atgggctggatgcatgattccctgcattacatccagcaggacccggtgtaccgcgcccac
catcacaacgaactgagctttggtctggtgtacgcctggtccgagcgtttcatcctgccg
atctcccacgacgaagtggtgcacggcaagcactcgctgatcgacaagatgcccggcgat
cgctggcagaagttcgccaacctgcgggcctacctgagcttcatgtgggcccatccgggc
aagaagctgctgttcatgggctgcgagttcggccaatggcgcgagtggaaccacgaccag
caactggactggtacctgctgcaataccccgagcaccgcggggtgcagcaactggtgggg
gacctcaaccgcctgtatcgccagtacccggcgctgcacgaccaggacgacgtgccccag
ggtttccaatggctgatcggcgacgatgcgatcaacagcgtctatgcctggttgcgctgg
agcaagagcggcgaaccgctgctggtggtggccaacttcaccccggtgccacgccagggc
tatcgcgtcggcgtaccggtggcggggcgctggagcgagttgctcaacagcgattcgcaa
ctgtatgccggctccaactacggcaacggtggcgaggccttcagcgaagagcagagcagc
catggccaggccctgtccctggtgctcaacctgccgccgctggccgtactgatcctgcgc
cctgacagttga

DBGET integrated database retrieval system