KEGG   Pseudomonas protegens CHA0: PFLCHA0_c40050Help
Entry
PFLCHA0_c40050    CDS       T02671                                 

Gene name
srpA
Definition
protein SrpA (EC:1.-.-.-)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pprc00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pprc00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4502461..4503546)
Genome map
AA seq 361 aa AA seqDB search
MVDPSSKPDRPPLGPVSLTLRLGAIALVVAVAAGALAYVHGSLDPGRLTPKALVDVLETN
NGVHPGYRRNHAKGVCVIGYFESSGEARAYSTAQVFNEARTPVVGRFALPSGNPYAPDSS
VPIRSLALRFLQANGQQWRTGMNSMPVFPVGTPEAFYQLQQAGSPDPATGKPDPSKVPAF
FASHPEATPFLQWVKGAKPSASYASESYNGINAFYLVDGSGKRQAVRWGVVPETRDGPDA
GSAPQGADYLEQDLVRRLAQGPLRWRLQITLAAPGDPTDDASKAWPAQRPVINAGTLVLQ
STQAQNSGECRDINYDPLILPSGIQASDDPLLAARSAAYASSYLRRTSEVSQLPGAQEPR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggttgatccttcatcaaagcccgaccgcccacccctggggcccgtcagcctgaccctg
cgcctgggggcaatcgccctggtggtggccgtcgctgcgggggctctggcctatgtgcat
ggcagcctcgatcccggtcgcctgacccccaaggccctggtggatgtgctggaaaccaac
aatggcgtgcacccggggtatcgccgtaaccacgccaaaggggtgtgcgtcatcggctac
ttcgaaagcagcggcgaggcccgggcctactccacggcgcaggtgttcaatgaggcacgc
acgccggtggtggggcgctttgccctgcccagtggcaatccctatgcgccggacagcagc
gtgccgatccgcagcctggcgctgcgtttcctccaggccaacggccagcagtggcggacc
gggatgaacagcatgccggtgttcccggtgggcactcccgaagccttctatcagttgcaa
caggccggctcccctgatccggccacgggcaagccggacccgagcaaagtgccggcattc
ttcgccagtcatcccgaggcgacgccgttcctgcaatgggtcaagggcgccaaaccttcg
gccagctatgccagtgaaagctacaacgggatcaatgccttctacctggtggatggcagc
ggcaagcgccaggcagtgcgctggggggtagtgcccgagacccgggatgggcctgatgca
ggcagtgccccgcaaggcgccgactacctggagcaggacctggttcggcgcctggcccaa
gggccgctgcgctggcgcttgcagatcaccctggcggcgcccggcgaccccacggatgac
gccagcaaggcctggccggcgcagcggccggtaatcaacgccgggaccctggtgctgcaa
agcacccaggcgcagaacagcggcgagtgtcgggacatcaattacgacccgctgatcctg
cccagcggcatccaggcgtccgacgaccccctgctggcagcgcgctctgcggcctacgcc
agttcctacctgcgtcgcaccagcgaagtcagccaattgcccggcgcccaggagccacgt
ccatga

DBGET integrated database retrieval system