KEGG   Pseudomonas protegens CHA0: PFLCHA0_c40050Help
Entry
PFLCHA0_c40050    CDS       T02671                                 

Gene name
srpA
Definition
protein SrpA (EC:1.-.-.-)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PFLCHA0_c40050 (srpA)
  Amino acid metabolism
   00380 Tryptophan metabolism
    PFLCHA0_c40050 (srpA)
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PFLCHA0_c40050 (srpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4502461..4503546)
Genome map
AA seq 361 aa AA seqDB search
MVDPSSKPDRPPLGPVSLTLRLGAIALVVAVAAGALAYVHGSLDPGRLTPKALVDVLETN
NGVHPGYRRNHAKGVCVIGYFESSGEARAYSTAQVFNEARTPVVGRFALPSGNPYAPDSS
VPIRSLALRFLQANGQQWRTGMNSMPVFPVGTPEAFYQLQQAGSPDPATGKPDPSKVPAF
FASHPEATPFLQWVKGAKPSASYASESYNGINAFYLVDGSGKRQAVRWGVVPETRDGPDA
GSAPQGADYLEQDLVRRLAQGPLRWRLQITLAAPGDPTDDASKAWPAQRPVINAGTLVLQ
STQAQNSGECRDINYDPLILPSGIQASDDPLLAARSAAYASSYLRRTSEVSQLPGAQEPR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggttgatccttcatcaaagcccgaccgcccacccctggggcccgtcagcctgaccctg
cgcctgggggcaatcgccctggtggtggccgtcgctgcgggggctctggcctatgtgcat
ggcagcctcgatcccggtcgcctgacccccaaggccctggtggatgtgctggaaaccaac
aatggcgtgcacccggggtatcgccgtaaccacgccaaaggggtgtgcgtcatcggctac
ttcgaaagcagcggcgaggcccgggcctactccacggcgcaggtgttcaatgaggcacgc
acgccggtggtggggcgctttgccctgcccagtggcaatccctatgcgccggacagcagc
gtgccgatccgcagcctggcgctgcgtttcctccaggccaacggccagcagtggcggacc
gggatgaacagcatgccggtgttcccggtgggcactcccgaagccttctatcagttgcaa
caggccggctcccctgatccggccacgggcaagccggacccgagcaaagtgccggcattc
ttcgccagtcatcccgaggcgacgccgttcctgcaatgggtcaagggcgccaaaccttcg
gccagctatgccagtgaaagctacaacgggatcaatgccttctacctggtggatggcagc
ggcaagcgccaggcagtgcgctggggggtagtgcccgagacccgggatgggcctgatgca
ggcagtgccccgcaaggcgccgactacctggagcaggacctggttcggcgcctggcccaa
gggccgctgcgctggcgcttgcagatcaccctggcggcgcccggcgaccccacggatgac
gccagcaaggcctggccggcgcagcggccggtaatcaacgccgggaccctggtgctgcaa
agcacccaggcgcagaacagcggcgagtgtcgggacatcaattacgacccgctgatcctg
cccagcggcatccaggcgtccgacgaccccctgctggcagcgcgctctgcggcctacgcc
agttcctacctgcgtcgcaccagcgaagtcagccaattgcccggcgcccaggagccacgt
ccatga

DBGET integrated database retrieval system