KEGG   Pseudomonas protegens CHA0: PFLCHA0_c48660Help
Entry
PFLCHA0_c48660    CDS       T02671                                 

Definition
thermostable monoacylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pprc  Pseudomonas protegens CHA0
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5465078..5465944
Genome map
AA seq 288 aa AA seqDB search
MSKAEIDLGEGSAGFVLGTGPVGVLLIHGLTGTPTELRRVAQGLAKDGTCTVYVPTLPGH
CGDNSDLQATGWQDWYEGVRKTFADVEQRHEQVFVGGLSMGAVMSMYLASEHPGRISGLL
MYSTTLKYDGWSINKLAFLTPLLMKIPFGVHICRFEEKPPYGIKNERLRAIVEKQMKAGE
SSNAGLLTMEGVTVRELHRMNAVVKKRMPSILTPALVLHSSEDDITSTWNADYVERKLGG
PVTKILLDNCYHMITVDLQYQRVIELSADFIQQRVVTPAVREDYRQLA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggctgagatcgatctgggcgaaggcagcgccggcttcgttctcggcacgggt
ccggtcggggtcttgttgatccacggcctgaccggcaccccgacggaactccgtcgggtg
gcccagggcctggccaaggacggtacgtgcacggtgtacgtaccgaccctgcccgggcac
tgcggggacaacagcgatctgcaggccaccggctggcaggactggtacgagggcgtgcgc
aagaccttcgccgatgtagagcagcgccacgagcaggtgttcgtgggtggcctgtccatg
ggtgcggtgatgtccatgtacctggcctccgagcatccgggacggatcagcggcctgctg
atgtactccaccaccctgaagtacgacggctggagcatcaacaagctggccttcctcacc
ccgttgctgatgaagatcccctttggcgtgcacatctgccgcttcgaggaaaagccaccc
tacggcatcaagaacgaacgcctgcgggccatcgtcgagaagcagatgaaagccggtgaa
agcagcaatgccgggctcctgaccatggagggcgtgacggtgcgcgaattgcaccggatg
aacgccgtggtcaagaaacgcatgccgtcgatcctgaccccggccctggtgctgcactcc
agcgaagacgacatcaccagtacctggaacgccgactacgtggagcgcaagctcggcggc
ccggtgaccaagatcctcctcgacaactgctatcacatgatcaccgtggacctgcagtac
cagcgggtgatcgaactgagcgcagatttcatccagcagcgagtggtgacacctgcggtg
cgcgaagactaccgacagctggcgtga

DBGET integrated database retrieval system