KEGG   Pseudomonas protegens CHA0: PFLCHA0_c56760Help
Entry
PFLCHA0_c56760    CDS       T02671                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase FdhA
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00625  Chloroalkane and chloroalkene degradation
pprc00680  Methane metabolism
pprc01100  Metabolic pathways
pprc01120  Microbial metabolism in diverse environments
pprc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PFLCHA0_c56760 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PFLCHA0_c56760 (fdhA)
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PFLCHA0_c56760 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGL87404
UniProt: A0A2C9EUQ9
Position
complement(6313914..6315113)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGSGKVEVRKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QVGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPNRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPVRLAHAKAQGFEIADLSKD
TPLHEQIADLLGEPEVDCAVDAVGFEARGHGHAGAQHEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIA
DVVGVEVISLDDAPRGYGEFDAGVPKKFVIDPHKLFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgtggtgtcgtgtatctcggcagcggcaaggtcgaagtacggaaaatc
gactatccaaaaatgcaggacccgcgtggcaggaagattgagcacggcgtcatcctgcgc
gtggtctccaccaacatctgcggttcggaccaacacatggtccgtggccgtaccaccgcc
caggtcggcctggtcctgggccacgaaatcaccggcgaagtcatcgagaagggcagcgac
gtcgagaacctgaagatcggtgacctggtgtcggtgccgttcaacgtcgcgtgcgggcgc
tgccgctcctgcaaggaacagcacaccggggtctgcctgaccgtcaacccggctcgcgcc
ggtggtgcctacggctacgtcgacatgggcgactggaccggtggccaggccgagtacgtg
ctggtgccttacgccgacttcaacttgctgaaactgccgaatcgcgacaaggccatggag
aagatccgcgacttgacttgcctctccgacatcctacccactggttatcacggcgccgtc
actgctggcgttggcccgggcagcaccgtttatgtggccggtgccggtccggtcggtctg
gcggccgccgcttctgcgcgcttgctgggggcggcggtggtgattgtcggcgacgtcaac
ccggtgcgcctggcccacgccaaggcccagggttttgaaattgccgacctgtccaaggac
accccgctgcacgaacagatcgccgatttgcttggtgagccggaagtcgactgcgcagtg
gacgccgtgggcttcgaagcccgtggccacggccatgccggtgctcagcacgaagccccg
gccaccgtgctcaactcgctgatgggcgtggtgcgggtggcgggcaagatcggcattccc
ggcctgtacgtcaccgaagacccgggcgcggtggacgccgcggcgaagatgggcagcctg
agcatccgcttcggcctgggctgggccaagtcccacagcttccacaccggccagaccccg
gtgatgaaatacaaccgccaactgatgcaggccatcatgtgggaccgcatcaacatcgcc
gacgtggtgggggttgaagtcatcagcctcgacgacgccccgcgcggctatggcgagttc
gacgccggcgtgccgaagaaattcgtcatcgacccgcacaagctgttcagcgctgcctga

DBGET integrated database retrieval system