KEGG   Pan paniscus (bonobo): 100967245Help
Entry
100967245         CDS       T02283                                 

Definition
NADH-cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pps00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 305 aa AA seqDB search
MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLG
MIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLW
FTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggatccagacgagccccgtcctgctggcctccctgggggtggggctggtcactctg
ctcggcctggctgtgggctcctacttggttcggaggtcccgccggcctcaggtcactctc
ctggaccccaatgaaaagtacctgctacgactgctagacaagacgactgtgagccacaac
accaagaggttccgctttgccctgcccaccgcccaccacactctggggctgcctgtgggc
aaacatatctacctctccacccgaattgatggcagcctggtcatcaggccatacactcct
gtcaccagtgatgaggatcaaggctacgtggatcttgtcatcaaggtctacctgaagggt
gtgcaccccaaatttcctgagggagggaagatgtctcagtacctggatagcctgaaggtt
ggggatgtggtggagtttcgggggccaagcgggttgctcacttacactggaaaagggcat
tttaacattcagcccaacaagaaatctccaccagaaccccgagtggcgaagaaactggga
atgattgccggcgggacaggaatcaccccaatgctacagctgatccgggccatcctaaaa
gtcccagaagatccaacccagtgctttctgctttttgccaaccagacagaaaaggatatc
atcttgcgggaggacttagaggaactgcaggcccgctatcccaatcgctttaagctctgg
ttcactctggatcatcccccaaaagattgggcctacagcaagggctttgtgactgccgac
atgatccgggaacacctgcctgctccaggggatgatgtgctggtactgctttgtgggcca
cccccaatggtgcagctggcctgccatcccaacttggacaaactgggctactcacaaaag
atgcgattcacctactga

DBGET integrated database retrieval system