KEGG   Pan paniscus (bonobo): 100967254Help
Entry
100967254         CDS       T02283                                 

Gene name
MAPK7
Definition
mitogen-activated protein kinase 7
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100967254 (MAPK7)
 Cellular Processes
  Cell communication
   04540 Gap junction
    100967254 (MAPK7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100967254 (MAPK7)
   04921 Oxytocin signaling pathway
    100967254 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100967254 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100967254 (MAPK7)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100967254 (MAPK7)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100967254 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 816 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPAPTSVPAPAPAPMPTPTPV
QPTSPLPGPVAQPTGPQPQPAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPVPPQIATS
TSLLAAQSLVPPPGLPGSSTPGILPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaaacacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaatctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgactgag
tatgtggccacgcgctggtaccgtgcgcccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactacgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgcgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccaccg
tgccccggccctgcacctgacaccattgatctgaccctgcagccacctccaccagtcagt
gagcctgccccaccaaagaaagagggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagtgcacccctggag
gctcctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttggaacgctggactcgaatggcccggcccgcagcc
ccagcccccacctctgtgccggcccctgccccagcgccaatgccaaccccaaccccagtc
caacctaccagtcctcttcctggccctgtagcccagcccactggcccgcaaccacaacct
gcgggctctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccc
caccccactggccctcctgggcccatccctgtccccgtgccaccccagattgccacctcc
accagcctcctggctgcccagtcacttgtgccaccccctgggctgcctggctccagcacc
ccagggattttgccttacttcccacctggcctgccacccccagacgccgggggagcccct
cagtcttccatgtcagagtcacctgatgtcaaccttgtgacccaacagctatctaagtca
caggtggaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggc
tacggtgttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggct
gatgggccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgac
tggctcgaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccag
atggactccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system