KEGG   Pan paniscus (bonobo): 100967330Help
Entry
100967330         CDS       T02283                                 

Gene name
KAT7
Definition
K(lysine) acetyltransferase 7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100967330 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 581 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKAPTERQLRYKEKVAELRKK
RNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQI
TEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVW
KHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEAD
NTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERP
LSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKG
KHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagaaagtgatggcacatcccgacgatctgct
cgagtcacccgctcctcagccaggctaagccagagttctcaagattccagtcctgttcga
aatctgcagtcttttggcactgaggagcctgcttactctaccagaagagtgacccgtagt
cagcagcagcctaccccagtgacaccgaaaaaataccctcttcggcagactcgttcatct
ggttcagaaactgagcaagtggttgatttttcagatagagaaactaaaaatacagctgat
catgatgagtcaccgcctcgaactccaactggaaatgcaccttcttctgagtctgacata
gacatctccagccccaatgtgtctcacgatgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcatcgccccaagcgccgtcgcttccatgaaagctacaac
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacat
gagagacatttctccatctcaggatgcccactctatcataacctctcagctgacgaatgc
aaggcaccaacggagaggcagcttcgatataaggaaaaagtggctgaactcaggaagaaa
agaaattctggactgagcaaagaacagaaagagaaatatatggaacacagacagacctat
gggaacacacgggaacctcttttagaaaacctgacaagcgaatatgacttggatcttttc
cgaagagcacaagcccgggcttcagaggatttggagaagttaaggctgcaaggccaaatc
acagagggaagcaacatgattaaaacaattgcttttggccgctatgagcttgatacctgg
taccattctccatatcctgaagaatatgcacggctgggacgtctctatatgtgtgaattc
tgtttaaaatatatgaagagccaaacgatactccgccggcacatggccaaatgtgtgtgg
aaacacccacctggtgatgagatatatcgcaaaggttcaatctctgtgtttgaagtggat
ggcaagaaaaacaagatctactgccagaacctgtgcctgttggccaaactttttctggac
cacaagacattatattatgatgtggagcccttcctgttctatgttatgacagaggcggac
aacactggctgtcacctgattggatatttttccaaggaaaagaattcattcctcaactac
aacgtctcctgtatccttactatgcctcagtacatgagacagggctatggcaagatgctt
attgatttcagttatttgctttccaaagtcgaagaaaaagttggctccccagaacgtcca
ctctcagatctggggcttataagctatcgcagttactggaaagaagtacttctccgctac
ctgcataatttccaaggcaaagagatttctatcaaagaaatcagtcaggagacggctgtg
aatcctgtggacattgtcagcactctgcaagcccttcagatgctcaagtactggaaggga
aaacacctagttttaaagagacaggacctgattgatgagtggatagccaaagaggccaaa
aggtccaactccaataaaaccatggatcccagctgcttaaaatggacccctcccaagggc
acttaa

DBGET integrated database retrieval system