KEGG   Pan paniscus (bonobo): 100967331Help
Entry
100967331         CDS       T02283                                 

Gene name
USP4
Definition
ubiquitin specific peptidase 4 (proto-oncogene)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100967331 (USP4)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100967331 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 962 aa AA seqDB search
MAEGGGCRERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRN
FTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASAL
YGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGED
EEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKIKGQPCPKRLFTFSLVNSYGTADIN
SLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRDC
IELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTV
VEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSN
VSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQGLGDDEACSMD
TN
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggtggaggctgccgtgagcgaccggatgcggagactcagaagtccgagctt
ggagccttaatgaggaccacactccaacgcggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggacatgtacaatgtgggt
gaacataacctatttcctggcccaatagacaactctgggctattttcagatcctgagagt
cagaccttgaaagaacacttaattgatgaattggactatgtattggtccccaccgaggcg
tggaataaactactaaactggtacggctgtgtagaaggccagcaacccatcgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtcgaggtgtatttgctggaacta
aagctctgtgagaacagtgaccccaccaatgtgctgagttgccatttcagcaaggcagac
accattgcaaccatcgagaaagagatgcggaagctattcaacatccctgcggagcgtgaa
acacggctctggaacaaatacatgagcaacacctacgagcagttgagcaagctagacaac
actgtccaggatgctgggctataccagggtcaggtgctagtaattgagcctcaaaatgaa
gatggcacatggcccaggcagaccttgcagtcaaaatcaagcactgcgcctagcagaaat
tttactacctctccaaaatcatcagcaagtccctattcctcagtgtctgcctctctcatt
gcaaatggtgatagcactagcacctgtgggatgcacagttccggtgtcagcaggggtgga
tctggcttttctgcttcgtataattgtcaggagccaccatcctctcatatacaacctggg
ctctgtggacttggaaacctgggaaacacctgcttcatgaactccgctttgcagtgtttg
agtaacactgcaccactgactgactactttctcaaagatgagtatgaagccgaaatcaac
agagacaaccctctggggatgaaaggggaaattgcagaagcctatgccgaactcattaag
cagatgtggtctggaagggacgcccatgtggcacctcgcatgttcaaaactcaagtggga
cgttttgctcctcaattttctggctaccagcaacaagattctcaggagctgctggccttt
cttctagatggattgcatgaagatctgaaccgggtaaagaaaaagccctacttggagctg
aaggatgccaatgggcggccagatgcggtggtggcaaaggaagcctgggagaatcacagg
ttgaggaatgattctgtgattgtggatactttccatggcctcttcaaatctactttggtt
tgcccagaatgtgctaaggtttctgtgacctttgacccattttgctatctaacgctgcca
ctgcccttgaagaaagatcgagttatggaggttttcctggttcctgctgaccctcactgc
agacctactcagtaccgtgtgactgtgccgctgatgggggctgtgtccgacctgtgcgag
gctctctccaggctgtctggcattgctgcagaaaatatggtggtcgcagatgtgtataat
caccgattccacaaaattttccaaatggatgaaggtttaaaccacatcatgcctcgggat
gacattttcgtgtacgaggtctgcagcacttccgtggatggctcggaatgtgtcacgctt
ccagtctacttcagggagaggaagtccaggccatcaagcacttcctccgcatcagcgcta
tatgggcagccactattgctttctgtccccaagcacaagttaacccttgagtctttgtac
caggctgtttgtgatcgtatcagccgctatgtgaaacagcctttaccggatgagtttggc
agctcacccttggagccaggggcctgcaatggctccaggaacagctgtgaaggagaagat
gaggaagaaatggagcatcaggaagaaggcaaagagcagctttcagaaacagaaggcagt
ggggaagatgagccaggaaatgaccccagtgagaccacccaaaagatcaaaggccagccc
tgcccaaaaaggctttttaccttcagtcttgtgaactcctatggaacagctgacataaat
tcacttgcagctgatggaaaactacttaaactcaactctcgatctacactggccatggat
tgggacagtgaaactcggagactttactatgatgagcaagaatctgaggcctacgagaag
catgtgagcatgttgcagcctcagaagaagaagaagaccacagtggccctgagagactgc
atcgagctcttcaccaccatggagacccttggggagcatgacccctggtactgtcccaac
tgtaagaagcatcaacaggccacaaaaaagtttgacctatggtccttgcccaagatcctg
gtggtccacctcaaacgtttctcctacaacagatactggagggataagctcgacacagtc
gtagaattcccaatcagagggctgaacatgtccgagtttgtctgtaacctgtcagcaagg
ccttatgtgtacgacctcattgccgtgtccaatcattatggagccatgggggttggccac
tacactgcatatgcgaagaacaaactgaatggtaaatggtattactttgatgatagcaac
gtgtccctggcctctgaggatcagatagtgactaaagcagcttatgtgctattttaccaa
cgtcgagatgatgaattttataagacaccttcacttagcagttctggttcctctgatgga
gggacacgaccaagcagctctcagcagggcttgggggatgatgaggcttgcagcatggac
accaactaa

DBGET integrated database retrieval system