KEGG   Pan paniscus (bonobo): 100967492Help
Entry
100967492         CDS       T02283                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pps01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pps00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pps00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pps00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 386 aa AA seqDB search
MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLGKKGCAGVITLNRPKFLNAL
TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTEEDLNNHFKSLGSSDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcgggagatgtggaggctcatgtcgaggtttaatgcattcaaaaggactaat
accatactgcaccatttgagaatgtccaagcacacagatgcagcagaagaggtgctattg
ggaaaaaaaggttgcgcgggagtcataacactaaacagaccaaagttcctcaatgcactg
actcttaatatgattcggcagatttatccacagctaaagaagtgggaacaagatcctgaa
actttcctgatcattataaagggagcaggaggaaaggctttctgtgccgggggtgatatc
agagtgatctcagaagctgaaaaggcaaaacagaagatagctccagttttcttcagagaa
gaatatatgctgaacaatgctgttggttcttgccagaaaccttatgttgcacttattcat
ggaattacaatgggtgggggagttggtctctcagtccatgggcaatttcgagtggctaca
gaaaagtgtctttttgctatgccagaaactgcaataggactgttccctgatgtgggtgga
ggttatttcttgccacgactccaaggaaaacttggttacttccttgcattaacaggattc
agactaaaaggaagagatgtgtacagagcaggaattgctacacactttgtagattctgaa
aagttggccatgttagaggaagatttgttagccttgaaatctccttcaaaagaaaatatt
gcatctgtcttagaaaattaccatacagagtctaagattgatcgagacaagtcttttata
cttgaggaacacatggacaaaataaacagttgtttttcagccaatactgtggaagaaatt
attgaaaacttacagcaagatggttcatcttttgccctagagcaattgaaggtaattaat
aaaatgtctccaacatctctaaagatcacactaaggcaactcatggaggggtcttcaaag
accttgcaagaagtactaactatggagtatcggctaagtcaagcttgtatgagaggtcat
gactttcatgaaggcgttagagctgttttaattgataaagaccagagtccaaaatggaaa
ccagctgatctaaaagaagttactgaggaagatttgaataatcactttaagtctttggga
agcagtgatttgaaattttga

DBGET integrated database retrieval system