KEGG   Pan paniscus (bonobo): 100967492Help
Entry
100967492         CDS       T02283                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100967492 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100967492 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100967492 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100967492 (HIBCH)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100967492 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 386 aa AA seqDB search
MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLGKKGCAGVITLNRPKFLNAL
TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTEEDLNNHFKSLGSSDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcgggagatgtggaggctcatgtcgaggtttaatgcattcaaaaggactaat
accatactgcaccatttgagaatgtccaagcacacagatgcagcagaagaggtgctattg
ggaaaaaaaggttgcgcgggagtcataacactaaacagaccaaagttcctcaatgcactg
actcttaatatgattcggcagatttatccacagctaaagaagtgggaacaagatcctgaa
actttcctgatcattataaagggagcaggaggaaaggctttctgtgccgggggtgatatc
agagtgatctcagaagctgaaaaggcaaaacagaagatagctccagttttcttcagagaa
gaatatatgctgaacaatgctgttggttcttgccagaaaccttatgttgcacttattcat
ggaattacaatgggtgggggagttggtctctcagtccatgggcaatttcgagtggctaca
gaaaagtgtctttttgctatgccagaaactgcaataggactgttccctgatgtgggtgga
ggttatttcttgccacgactccaaggaaaacttggttacttccttgcattaacaggattc
agactaaaaggaagagatgtgtacagagcaggaattgctacacactttgtagattctgaa
aagttggccatgttagaggaagatttgttagccttgaaatctccttcaaaagaaaatatt
gcatctgtcttagaaaattaccatacagagtctaagattgatcgagacaagtcttttata
cttgaggaacacatggacaaaataaacagttgtttttcagccaatactgtggaagaaatt
attgaaaacttacagcaagatggttcatcttttgccctagagcaattgaaggtaattaat
aaaatgtctccaacatctctaaagatcacactaaggcaactcatggaggggtcttcaaag
accttgcaagaagtactaactatggagtatcggctaagtcaagcttgtatgagaggtcat
gactttcatgaaggcgttagagctgttttaattgataaagaccagagtccaaaatggaaa
ccagctgatctaaaagaagttactgaggaagatttgaataatcactttaagtctttggga
agcagtgatttgaaattttga

  All links  
No link information was found.   
DBGET integrated database retrieval system