KEGG   Pan paniscus (bonobo): 100967683Help
Entry
100967683         CDS       T02283                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 396 aa AA seqDB search
MSLGWLERPPALSRAAGDGARRLSGSRRGDVWLTSSAAGLLRSVAGGSWCGGQLRARGGS
GRCVARAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLI
FLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSE
FKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNG
RLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQ
KIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYL
PFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagggtggctagagcgtcctcccgcgctcagtcgcgctgcaggtgacggcgcc
cggaggctgtcgggaagtaggcggggtgacgtgtggttgacgagctcggcggcgggtttg
ctgagatctgtggccggcggcagctggtgcggggggcagctgagagcgagaggtggatcg
gggcggtgtgtggccagggccatgacgggcaatgccggggagtggtgcctcatggaaagc
gaccccggggtcttcaccgagctcattaaaggattcggttgccgaggagcccaagtagaa
gaaatatggagtttagagcctgagaattttgaaaaattaaagccagttcatgggttaatt
tttcttttcaagtggcagccaggagaagaaccagcaggctctgtggttcaggactcccga
cttgacacgatattttttgctaagcaggtaattaataatgcttgtgctactcaagccata
gtgagtgtgttactgaactgtacccaccaggatgtccatttaggcgagacattatcagag
tttaaagaattttcacaaagttttgatgcagctatgaaaggcttggcactgagcaattca
gatgtgattcgacaagtacacaacagtttcgccagacagcaaatgtttgaatttgatacg
aagacatcagcaaaagaagaagatgcttttcactttgtcagttatgttcctgttaatggg
agactgtatgaattagatggattaagagaaggaccgattgatttaggtgcatgcaatcaa
gatgattggatcagtgcagtaaggcctgtcatagaaaaaaggatacaaaagtacagtgaa
ggtgaaattcgatttaatttaatggccattgtgtctgacagaaaaatgatatatgagcag
aagatagcagagttacaaagacaacttgcagaggaggaacccatggatacagatcaaggt
aatagtatgttaagtgctattcagtcagaagttgccaaaaatcagatgcttattgaagaa
gaagtacagaaattaaaaagatacaagattgagaatatcagaaggaagcataattatctg
cctttcattatggaattgttaaagactttagcagaacaccagcagttaataccactagta
gaaaaggcaaaagaaaaacagaacgcaaagaaagctcaggaaaccaaatga

DBGET integrated database retrieval system