KEGG   Pan paniscus (bonobo): 100967683Help
Entry
100967683         CDS       T02283                                 

Gene name
UCHL5
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase L5
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100967683 (UCHL5)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100967683 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 329 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggagcccaagtagaagaaatatggagtttagagcct
gagaattttgaaaaattaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaaccagcaggctctgtggttcaggactcccgacttgacacgatattttttgct
aagcaggtaattaataatgcttgtgctactcaagccatagtgagtgtgttactgaactgt
acccaccaggatgtccatttaggcgagacattatcagagtttaaagaattttcacaaagt
tttgatgcagctatgaaaggcttggcactgagcaattcagatgtgattcgacaagtacac
aacagtttcgccagacagcaaatgtttgaatttgatacgaagacatcagcaaaagaagaa
gatgcttttcactttgtcagttatgttcctgttaatgggagactgtatgaattagatgga
ttaagagaaggaccgattgatttaggtgcatgcaatcaagatgattggatcagtgcagta
aggcctgtcatagaaaaaaggatacaaaagtacagtgaaggtgaaattcgatttaattta
atggccattgtgtctgacagaaaaatgatatatgagcagaagatagcagagttacaaaga
caacttgcagaggaggaacccatggatacagatcaaggtaatagtatgttaagtgctatt
cagtcagaagttgccaaaaatcagatgcttattgaagaagaagtacagaaattaaaaaga
tacaagattgagaatatcagaaggaagcataattatctgcctttcattatggaattgtta
aagactttagcagaacaccagcagttaataccactagtagaaaaggcaaaagaaaaacag
aacgcaaagaaagctcaggaaaccaaatga

DBGET integrated database retrieval system