KEGG   Pan paniscus (bonobo): 100968153Help
Entry
100968153         CDS       T02283                                 

Gene name
DLAT
Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100968153 (DLAT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100968153 (DLAT)
   00020 Citrate cycle (TCA cycle)
    100968153 (DLAT)
   00620 Pyruvate metabolism
    100968153 (DLAT)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100968153 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 647 aa AA seqDB search
MWRVCARRAQNVAPWAGLEARWTALQEVPATPRVTSRSGPAPARRNSVTTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWXKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSAAPTPQAAPAPTPAASASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
SAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPL
AKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFI
IKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIAND
VVSLAAKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtatgtgcgcgacgggcccagaatgtagccccatgggcgggactcgaggct
cggtggacggccttgcaggaggtacccgcaactccacgagtgacctcgcgatctggcccg
gctcccgctcgtcgcaacagcgtgactacagggtatggcggggtccgggcactgtgcggc
tggacccccagttctggggccacgccgcggaaccgcttactgctgcagcttttggggtcg
cccggccgccgctattacagtcttcccccgcatcagaaggttccattgccttctctttcc
cccacaatgcaggcaggcaccatagcccgttggngaaaaaaagagggggacaaaatcaac
gaaggtgacctaattgcagaggttgaaactgataaagccactgttggatttgagagcctg
gaggagtgttatatggcaaagatacttgttgctgaaggtaccagggatgttcccatcgga
gcgatcatctgtatcacagttggcaagcctgaggatattgaggcctttaaaaattataca
ttggattcctcagcagcacctaccccacaagcggccccagcaccaacccctgctgccagt
gcttcgccacctacaccttctgctcaggctcctggtagctcatatccccctcacatgcag
gtacttcttcctgccctctctcccaccatgaccatgggcacagttcagagatgggaaaaa
aaagtgggtgagaagctaagtgaaggagacttactggcagagatagaaactgacaaagcc
actataggttttgaagtacaggaagaaggttatctggcaaaaatcctggtccctgaaggc
acaagagatgtccctctaggaaccccactctgtatcattgtagaaaaagaggcagatata
tcagcatttgctgactataggccaaccgaagtaacagatttaaaaccacaagcgccacca
cctaccccacccccggtggccgctgttcctccaactccccagcctttagctcctacacct
tcagcaccctgcccagctactcctgctggaccaaagggaagggtgtttgttagccctctt
gcaaagaagttggcagtagagaaagggattgatcttacacaagtaaaagggacaggacca
gatggtagaatcaccaagaaggatatcgactcttttgtgcctagtaaagttgctcctgct
ccagcagctgttgtgcctcccacaggtcctggaatggcaccagttcctacaggtgtcttc
acagatatcccaatcagcaacattcgtcgggttattgcacagcgattaatgcaatcaaag
caaaccatacctcattattacctttctatcgatgtaaatatgggagaagttttgttggta
cggaaagaacttaataagatattagaagggagaagcaaaatttctgtcaatgacttcatc
ataaaagcttcagctttggcatgtttaaaagttcccgaagcaaattcttcttggatggac
acagttataagacaaaatcatgttgttgatgtcagtgttgcggtcagtactcctgcagga
ctcatcacacctattgtgtttaatgcacatataaaaggagtggaaaccattgctaatgat
gttgtttctttagcagccaaagcaagagagggtaaactacagccacatgaattccagggt
ggcacttttacgatctccaatttaggaatgtttggaattaagaatttctctgctattatt
aacccacctcaagcatgtattttggcaattggtgcttcagaggataaactggtccctgca
gataatgaaaaagggtttgatgtggctagcatgatgtctgttacactcagttgtgatcac
cgggtggtggatggagcagttggagcccagtggcttgctgagtttagaaagtaccttgaa
aaacctatcactatgttgttgtaa

DBGET integrated database retrieval system