KEGG   Pan paniscus (bonobo): 100968174Help
Entry
100968174         CDS       T02283                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100968174 (PDK1)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100968174 (PDK1)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100968174 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 436 aa AA seqDB search
MRLARLLRGAAFAGPGPGLRAAGSSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKDGYENARRLC
DLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP
IQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLP
ISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW
CVPSREPKDMTTFRSA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgcttcgcggagccgcctttgccggcccgggcccggggctgcgc
gccgccggctccagccgcagcttcagctcggactcgggctccagcccggcgtccgagcgc
ggcgttccgggccaggtggacttctacgcgcgcttctcgccgtccccgctctccatgaag
cagttcctggacttcggatcagtgaatgcttgtgaaaagacctcatttatgtttctgcgg
caagagttgcctgtcagactggcaaatataatgaaagaaataagtctccttccagataat
cttctcaggacaccatccgttcaattggtacaaagctggtatatccagagtcttcaggag
cttcttgattttaaggacaaaagtgctgaggatgctaaagctatttatgactttacagat
actgtgatacggatcagaaaccgacacaatgatgtcattcccacaatggcccagggtgtg
attgaatacaaggagagctttggggtggatcctgtcaccagccagaatgttcagtacttt
ttggatcgattctacatgagtcgcatttcaattagaatgttactcaatcagcactcttta
ttgtttggtggaaaaggcaaaggaagtccatctcatcgaaaacacattggaagcataaat
ccaaactgcaatgtagttgaagttattaaagatggctatgaaaatgctaggcgtctgtgt
gatttgtattatattaactctcccgaactagaacttgaagaactaaatgcaaaatcacca
ggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgtttgaactt
ttcaagaatgcaatgagagccactatggaacaccatgccaacagaggtgtttacccccct
attcaagttcatgttacgctgggtaatgaggatttgactgtgaagatgagtgaccgagga
ggtggcgttcctttgaggaaaattgacagacttttcaactacatgtattcaactgcacca
agacctcgtgttgagacctcccgcgcggtgcctctggctggttttggttatggattgccc
atatcacgtctttacgcacaatacttccaaggagacctgaagctgtattccctagagggt
tacgggacagatgcagttatctacattaaggctctgtcaacagactcaatagaaagactc
ccagtgtataacaaagctgcctggaagcattacaacaccaaccacgaggctgatgactgg
tgcgtccccagcagagaacccaaagacatgacgacgttccgcagtgcctag

DBGET integrated database retrieval system