KEGG   Pan paniscus (bonobo): 100968239Help
Entry
100968239         CDS       T02283                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100968239 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100968239 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100968239 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    100968239 (MGLL)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100968239 (MGLL)
Peptidases [BR:pps01002]
 Serine Peptidases
  Family S33
   100968239 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggcggaccccgcagagcattccctaccaggacctccct
cacctggtcaatgcagacggacagtacctcttctgcaggtactggaaacccacaggcacg
cccaaggccctcatctttgtgtcccatggagccggagagcacagtggccgctatgaagag
ctggctcggatgctgatggggctggacctgctggtgttcgcccacgaccatgttggccac
ggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcgtcagggatgtg
ttgcagcatgtggattccatgcagaaagactaccctgggcttcctgtcttccttctgggc
cactccatgggaggcgccatcgccatcctcacggccgcagagaggccgggccacttcgcc
ggcatggtactcatttcgcctctggttcttgccaatcctgaatctgcaacaactttcaag
gtccttgctgcgaaagtgctcaaccttgtgctgccaaacttgtccctcgggcccatcgac
tccagcgtgctctctcggaataagacagaggtcgacatttataactcagaccccctgatc
tgccgggcagggctgaaggtgtgcttcggcatccaactgctgaatgccgtctcacgggtg
gagcgcgccctccccaagctgactgtgcccttcctgctgctccagggctctgccgatcgc
ctgtgtgacagcaaaggggcctacctgctcatggagttagccaagagccaggacaagact
ctcaagatttatgaaggtgcctaccatgttctccacaaggagcttcctgaagtcaccaac
tccgtcttccatgaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcg
tccccaccctga

DBGET integrated database retrieval system