KEGG   Pan paniscus (bonobo): 100969003Help
Entry
100969003         CDS       T02283                                 

Gene name
STAMBP
Definition
STAM binding protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100969003 (STAMBP)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100969003 (STAMBP)
Peptidases [BR:pps01002]
 Metallo Peptidases
  Family M67
   100969003 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 424 aa AA seqDB search
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTE
YNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLK
IVQEFGKVDPGLGGPLVPDLEKPSLDVFPTSTVSSTEPSDCHTTVRPAKPPVVDRSLKPG
ALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL
IPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggagatgtgagcctcccgcccgaagaccgggtgagggctctctcccag
ctgggtagtgcggtagaggtgaatgaagacattccaccccgtcggtacttccgctctgga
gttgagattatccgaatggcatccatttactctgaggaaggcaacattgaacatgccttc
atcctctataacaagtatatcacgctctttattgagaaactaccaaagcatcgagattac
aaatctgctgtcattcctgaaaagaaagacacagtaaagaaattaaaggagattgcattt
cccaaagcggaagagctgaaggcagagctgttaaaacgatataccaaagaatatacagaa
tataatgaagaaaagaagaaggaagcagaggaattggcccggaacatggccatccagcaa
gagctggaaaaggaaaaacagagggtagcacaacagaagcagcagcaattggaacaggaa
cagttccatgccttcgaggagatgatccggaaccaggagctagaaaaagagcgactgaaa
attgtacaggagtttgggaaggtagaccctggcctaggtggcccactagtgcctgacttg
gagaagccctccttagatgtgttccccacctcaacagtctcatccacagagccttcagac
tgtcacacaactgtaaggccagctaagccacctgtggtggacaggtccttgaaacctgga
gcactgagcaactcagaaagtattcccacaatcgatggattgcgccatgtggtggtgcct
gggcggctgtgcccacagtttctccagttagccagtgccaacactgcccggggagtggag
acatgtggaattctctgtggaaaactgatgaggaatgaatttaccattacccatgttctc
atccccaagcaaagtgctgggtctgattactgcaacacagagaacgaagaagaacttttc
ctcatacaggatcagcagggcctcatcacactgggctggattcatactcaccccacacag
accgcgtttctctccagtgttgacctacacactcactgctcttaccagatgatgttgcca
gagtcagtagccattgtttgctcccccaagttccaggaaactggattctttaaactaact
gaccatggactagaggagatttcttcctgtcgccagaaaggatttcatccacacagcaag
gatccacctctgttctgtagctgcagccatgtgactgttgtggacagagcagtgaccatc
acagaccttcgatga

DBGET integrated database retrieval system