KEGG   Pan paniscus (bonobo): 100969041Help
Entry
100969041         CDS       T02283                                 

Gene name
TTK
Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100969041 (TTK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100969041 (TTK)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100969041 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 857 aa AA seqDB search
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLNLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENLPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSFCKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQQQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQHIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFGKKRGKK
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgaactaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
aacccagaggactggttgaatttgttgctcaaactagagaaaaacagtgttccgctaagt
gatgctcttttaaataaattgattggtcgttacagtcaagcaattgaagcgcttccccca
gataaatatggccaaaatgagagttttgctagaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatatcttttgcacaatttgaactgtcacaaggtaatgtcaaa
aaaagtaaacaacttcttcaaaaagctgtagaacgtggagcagtaccactagaaatgctg
gaaattgccctgcggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagaatttatcagcatctacggtattaactgcccaagaatcattttccggttcacttggg
catttacagaataggaacaacagttgtgattccagaggacagactactaaagccaggttt
ttatatggagagaacctgccaccacaagatgcagaaataggttatcggaattcattgaga
caaactaacaaaactaaacagtcatgcccatttggaagagtcccagttaaccttctaaat
agcccagattgtgatgtgaagacagatgattcagttgtaccttgttttatgaaaagacaa
acctctagatcagaatgccgagatttggttgtgcccggatctaaaccaagtggaaatgat
tcctgtgaattaagaaatttaaagtctgttcaaaatagtcatttcaaggaacctctggtg
tcagatgaaaagagttctgaacttattattactgattcaataaccctgaagaataaaacg
gaatcaagtcttctagctaaattagaagaaactaaagagtatcaagaaccagaggttcca
gagagtaaccagaaacagtggcaatctaagagaaagtcagagtgtattaaccagaatcct
gctgcatcttcaaatcactggcagattccggagttagcccgaaaagttaatacagagcag
aaacataccacttttgagcaacctgtcttttcagtttcaaaacagtcaccaccaatatca
acatctaaatggtttgacccaaaatctttttgtaagacaccaagcagcaataccttggat
gattacatgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcag
ttgtcaacaccttatggccaacctgcctgtttccagcagcaacagcagcaaatacttgcc
actccacttcaaaatttacaggttttagcatcttcttcagcaaatgaatgcatttcggtt
aaaggaagaatttattccatattaaagcagataggaagtggaggttcaagcaaggtattt
caggtgttgaatgaaaagaaacagatatatgctataaaatatgtgaacttagaagaagca
gataaccaaactcttgatagttaccggaacgaaatagcttatttgaataaactacaacaa
cacagtgataagatcatccgactttatgattatgaaatcacggaccagcacatctacatg
gtaatggagtgtggaaatattgatcttaatagttggcttaaaaagaaaaaatccattgat
ccatgggaacgcaagagttactggaaaaatatgttagaggcagttcacacaatccatcaa
catggcattgttcacagtgatcttaaaccagctaactttctgatagttgatggaatgcta
aagctaattgattttgggattgcaaaccaaatgcaaccagatacaacaagtattgttaaa
gattctcaggttggcacagttaattatatgccaccagaagcaatcaaagatatgtcttcc
tccagagagaacgggaaatctaagtcaaagataagccccaaaagtgatgtttggtcctta
ggatgtattttgtactatatgacttatgggaagacaccatttcagcagataattaatcag
atttctaaattgcatgccataattgatcctaatcatgaaattgaatttcctgatattcca
gagaaagatcttcaagatgtgttaaagtgttgtttaaaaagggacccaaaacagaggata
tccattcctgagctcctggctcatccatatgttcaaattcaaactcatccaggtaaccaa
atggccaagggaaccactgaagaaatgaaatatgttctgggccaacttgttggtctgaat
tctcctaactccattttgaaagctgcaaaaactttatatgaacactatagtggtggtgaa
agtcataattcttcatcatccaagacttttggaaaaaaaaggggaaaaaaatga

DBGET integrated database retrieval system