KEGG   Pan paniscus (bonobo): 100969155Help
Entry
100969155         CDS       T02283                                 

Gene name
PPT1
Definition
palmitoyl-protein thioesterase 1
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pps  Pan paniscus (bonobo)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100969155 (PPT1)
  Lipid metabolism
   00062 Fatty acid elongation
    100969155 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100969155 (PPT1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100969155 (PPT1)
Lipid biosynthesis proteins [BR:pps01004]
 Fatty acid synthase
  Component type
   100969155 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 306 aa AA seqDB search
MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAVKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERL
VQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAH
IIPFLG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccggctgcctgtggctcttggctgtggctctcctgccatggacctgcgct
tctcgggcgctgcagcatctggacccgccggcgccgctgccgttggtgatctggcatggg
atgggagacagctgttgcaatcccttaagcatgggtgctgttaaaaaaatggtggagaag
aaaatacctggaatttacgtcttatctttagagattgggaagaccctgatggaggacgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaacggtgtgtcagacacttgct
aaggatcctaaattgcagcaaggctacaatgctatgggattctcccagggaggccaattt
ctgagggcagtggctcagagatgcccttcacctcccatgatcaatctgatctcggttggg
ggacaacatcaaggtgtttttggactccctcgatgcccaggagagagctctcacatctgt
gacttcatccgaaaaacactgaatgctggggcgtactccaaagttgttcaggaacgcctc
gtgcaagctgaatactggcatgaccccataaaggaggatgtgtatcgcaaccacagcatc
ttcttggcagatataaatcaggagcggggtatcaatgagtcctacaagaaaaacctgatg
gccctgaagaagtttgtgatggtgaaattcctcaatgattccattgtggaccctgtagat
tcggagtggtttggattctacagaagtggccaagccaaggaaaccattcccttacaggag
acctccctgtacacacaggaccgcctggggctaaaggaaatggacaatgcaggacagcta
gtgtttctggctacagaaggggaccatcttcagttgtctgaagaatggttttatgcccac
atcataccattccttggatga

DBGET integrated database retrieval system