KEGG   Pan paniscus (bonobo): 100969236Help
Entry
100969236         CDS       T02283                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04919  Thyroid hormone signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100969236 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100969236 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100969236 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100969236 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100969236 (PLCD1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100969236 (PLCD1)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100969236 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100969236 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 TEP1_N
Motif
Other DBs
NCBI-GeneID: 100969236
NCBI-ProteinID: XP_003826153
Position
3
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEAVGSGETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVIRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG
VTNSLPSPEQLKGKILLKGKKLGGLLPPAGEGGPEATVVSDEDEAAEMEDEAVRSRVQHK
PKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALVRFLVEDYDASSKNDFIGQST
IPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgatgaggatctacag
gcgctgctgaagggcagccagctcctgaaggtgaagtccagctcatggaggagagagcgc
ttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgcgg
accccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatggggcaccgc
acggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttctccattgtc
ttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgatgcccagcac
tgggtgctggggctgcacaagatcatccaccactcaggctccatggaccagcgtcagaag
ctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagctat
gcccggaagatcttcagggagtgtgaccactcccagacagactccctggaggacgaggag
attgaggccttctacaagatgctgacccagcgggtggagatcgaccgcaccttcgccgag
gccgtgggctcaggggagactctgtcggtggatcagttagtgacgttcctgcagcaccag
cagcgggaggaggcggcagggcctgcgctggccctctccctcattgagcgctacgagccc
agcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacttactg
tcggctgacggcagcgccttcagcctggcacaccgccgtgtctaccaggacatgggccag
ccgcttagccactacctggtgtcctcttcacacaacacctacctgctggaggaccagcta
gccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgccgatgcctg
gagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggctatactttc
acttccaagatcctcttctgcgatgtgatcagggccatccgggactatgccttcaaggcg
tccccctaccctgtcatcctatccctggagaaccactgcacactggagcagcagcgcgtg
atggcgcggcacctgcacgccatcctgggccccatgctgttgaaccgaccactggatggg
gtcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctgaaggggaag
aagctcggggggctcctgccccctgcaggggagggtggccctgaggccactgtggtgtca
gacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtgcagcacaag
cccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatttactgcaag
agtgtccactttgggggcttctccagtcctggcacccctggacaggccttctacgagatg
gcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaacggctttgtc
cgccacaacgtggggcacctgagcagaatctacccggctggatggagaacagactcctcc
aactacagccccgtggagatgtggaatgggggctgccagattgtggccctgaatttccag
acacctgggccagagatggacgtgtaccagggccgcttccaggacaacggggcctgtggg
tacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccccgcgccctg
gctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcggggcagcag
ctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgacagtggagatc
catggtgtgagccgggacgtggccagccgccagactgctgtcatcaccaacaatggtttc
aacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgaccttgccctcgtc
cgcttcttggtggaagattatgatgcctcctccaagaatgacttcattggccagagtacc
atccccttgaacagcctcaagcaaggataccgccatgtccacctcatgtctaagaacggg
gaccagcatccatcagccaccctctttgtgaagatctccctccaggactag

DBGET integrated database retrieval system