KEGG   Pan paniscus (bonobo): 100969459Help
Entry
100969459         CDS       T02283                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100969459 (GSTO1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100969459 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    100969459 (GSTO1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100969459 (GSTO1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100969459 (GSTO1)
  Drug resistance
   01524 Platinum drug resistance
    100969459 (GSTO1)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100969459 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
10
AA seq 241 aa AA seqDB search
MSGESARSLGKGSAPPGPVPEGSIRVYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKMTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggagtcagccaggagcttggggaagggaagcgcgcccccggggccggtcccg
gagggctcgatccgcgtctacagcatgaggttctgcccgtttgctgagaggacgcgtctg
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctacgagtctgccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttggtaggaagctttattagaagccaaaataaagaagactatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
atgacgaccttctttggtggcaattctatctctatgattgattacctcatctggccctgg
tttgaacggctggaagcaatgaagttaaatgagtgtgtagaccacactccaaaactgaaa
ctgtggatggcagccatgaaggaagatcccacagtctcagccctgcttactagtgagaag
gactggcaaggtttcctagagctctacttacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system