KEGG   Pan paniscus (bonobo): 100969530Help
Entry
100969530         CDS       T02283                                 

Gene name
DOT1L
Definition
DOT1-like, histone H3 methyltransferase (S. cerevisiae)
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pps00310]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:pps05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1685 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGP
EGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMNTA
NPERKPKKNQTALDALHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLSHCQAQK
EEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLL
KARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGY
ELCGALSRPPSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPDYTRLSPAKIV
LRRHLSQDHTVPGRPAASELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARST
PSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGA
EPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGATQGPL
PEATKGDLPSDSGFSDPESEAKRRIVFTITTGAGSAKQSPSSKHSPLTTSARGDCVPSHG
QDSRKRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNINQPLEI
TAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARI
ERKIATISLESKSPPKTLENGGGLAGRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSP
LQASSTLSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPANGCTFGG
GLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLDGLAGLK
GEGSRGKEAGEGGLPLCGPTDKTPLLSGKAAKARDRELDLKNGHNLFISAAAVPPGSLLS
GPGLAPAAASAGGAASSAQTHRSFLGPFXAGPQFALGPMSLQANLGSVAGSSVLQSLFSS
VPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGEGHRAQGHQSITFSRGGHLLSVAAR
ALARLWELVLANAALPPPPTLLASNPEPALLQSLASLPPNQAFLPPTSAASLPPANASLS
IKLTSLPHKGARPSFTVHHQPLPRLALAQAAPGIPQASATGPSAVWVSLGMPPPYAAHLS
GVKPR
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgagactgaagtcgcccgtgggggctgagcccgccgtctac
ccgtggccgctgccggtctacgataaacatcacgatgctgctcatgaaatcatcgagacc
atccgatgggtctgtgaagaaatcccggatctcaagctcgctatggagaattacgtttta
attgactatgacaccaaaagcttcgagagcatgcagaggctctgcgacaagtacaaccgt
gccattgacagcatccaccagctgtggaagggcaccacgcagcccatgaagctgaacacg
cggccgtccactggactcctgcgccatatcctgcagcaggtctacaaccactcggtgacc
gaccccgagaagctcaacaactacgagcccttctcccccgaggtgtacggggagacctcc
ttcgacctggtggcccagatgattgacgagatcaagatgaccgacgacgacctgtttgtg
gacttggggagcggtgtgggccaggtcgtgctccaggttgctgctgccaccaactgcaaa
catcactatggcgtcgagaaagcagacatcccggccaagtatgcggagaccatggaccgc
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacattggagaga
ggcgatttcctctcagaagagtggagggagcgaatcgccaacacgagtgttatatttgtg
aataattttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaaaccctttgcacctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtggtggagctctcgcccctgaag
ggctcggtgtcgtggacggggaagccagtctcctactacctgcacactatcgaccgcacc
atacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggaacaggaggca
gcccggcgccgccagcagcgcgagagcaagagtaacgcggccacgcccactaagggccca
gagggcaaggtggccggccccgccgacgcccccatggactctggtgctgaggaagagaag
gcgggagcagccaccgtgaagaagccgtctccctccaaagcccgcaagaagaagctaaac
aagaaggggaggaagatggctggccgcaagcgcgggcgccccaagaagatgaacactgcg
aaccccgagcggaagcccaagaagaaccaaactgcactggatgccctgcacgctcagacc
gtgtctcagacggcggcctcctcaccccaggatgcctacagatcccctcacagcccgttc
taccagctacctccgagcgtgcagcggcactcccccaacccgctgctggtggcgcccacc
ccgcccgcgctgcagaagctgctagagtccttcaagatccagtacctgcagttcctggca
tacacaaagaccccccagtacaaggccagcctgcaggagctgctgggccaggagaaggag
aagaacgcccagctcctgggtgcggctcagcagctcctcagccactgccaggcccagaag
gaggagatcaggaggctgttccagcaaaaattggatgagctgggtgtgaaggcgctgacc
tacaatgacctgattcaagcgcagaaggagatctccgcccataaccagcagctgcgggag
cagtcggagcagctggagcaggacaaccgcgcgctccgcggccagagcttgcagctgctc
aaggctcgctgcgaggagctgcagctggactgggccacgctgtcgctggagaagctgttg
aaggagaagcaggccctgaagagccagatctcggagaagcagaggcactgcctggagctg
cagatcagcattgtggagctagagaagagccagcggcagcaggagctcctgcagctcaag
tcctgtgtgccgcctgacgatgccctgtccctgcacctgcgtgggaagggcgccctgggc
cgcgagctggagcctgacgccagccggctgcacctggagctggactgcaccaagttctcg
ctgcctcacttgagcagcatgagcccggagctctccatgaacggccaggctgctggctat
gagctctgcggtgcgctgagccggcctccgtcgaagcagaacacgccccagtacctggcc
tcacccctggaccaggaggtggtgccgtgtacccctagccacgtcggccggccgcgcctg
gagaagctgtctggcctagccgcacccgactacactaggctgtccccggccaagattgtg
ctgaggcggcacctgagccaggaccacacggtgcccggcaggccggccgccagtgagctg
cattcgagagctgagcacaccaaggagaacggccttccctaccagagccccagcgtgcct
ggcagcatgaagctgagccctcaggacccgcggcccctgtcccctggggccttgcagctt
gctggagagaagagcagtgagaagggcctgagagagcgcgcctatggcagcagcggggag
ctcatcaccagcctgcccatcagcatcccgctcagcaccgtgcagcccaacaagctcccg
gtcagcattcccctggccagcgtggtgctgcccagccgcgccgagagggcgaggagcacc
cccagtcccgtgctgcagccccgtgacccctcgtccacacttgaaaagcagattggtgct
aatgcccacggtgctgggagcagaagccttgccctggcccccgcaggcttctcctacgct
ggctcggtggccatcagcggggccttggcgggcagcccggcctctctcacacctggagcc
gagccggccaccttggatgagtcctccagctctgggagcctttttgccaccgtggggtcc
cgcagctccacgccacagcaccccctgctgctggcacagccccggaattcgcttcctgcc
tctcccgcccaccagctctcctccagtccccggcttggtggggccacccagggcccgctg
cccgaggccaccaagggggacctgccctccgattccggcttctcagatcctgagagtgaa
gccaagaggaggattgtgttcaccatcaccactggtgcgggcagtgccaagcagtcgccc
tccagcaagcacagccccctgaccaccagcgcccgtggggactgtgtgccgagccacggg
caggacagccgcaagcgcggccggcggaagcgagcatctgcggggacgcccagcttgagc
gcaggcgtgtcccccaagcgccgagccctgccgtccgtcgctggccttttcacacagcct
tcggggtctcccctcaacctcaactccatggtcagtaacatcaaccagcccctggagatt
acagccatctcgtccccggagacctccctgaagagctcccctgtgccctaccaggaccac
gaccagccccccgtgctcaagaaggagcggcctctgagccagaccaatggggcacactac
tccccactcacctcagacgaggagccaggctctgaggacgagcccagcagtgctcgaatt
gagagaaaaattgcaacaatctccttagaaagcaaatctcccccgaaaaccttggaaaac
ggtggtggcttggcgggaaggaagcccgcgcccgccggcgagccagtcaatagcagcaag
tggaagtccaccttctcgcccatctccgacatcggcctggccaagtcggcggacagcccg
ctgcaggccagctccaccctcagccagaactccctgttcacgttccggcccgccctggag
gagccctctgccgatgccaagctggccgctcaccccaggaaaggctttcccggctccctg
tcgggggctgacggactcagcccgggcaccaaccctgccaacggctgcaccttcggcggg
ggcctggccgcggacctgagtttacacagcttcagtgatggtgcttctcttccccacaag
ggccccgaggcggccggcctgagctccccgctgagcttcccctcgcagcgcggcaaggag
ggctcggacgccaaccctttcctgagcaagaggcagctggacggcctggctgggctgaag
ggcgagggcagccgcggcaaggaggcaggggagggcggcctaccgctgtgcgggcccacg
gacaagaccccactgctgagcggcaaggccgccaaggcccgggaccgcgagctcgacctc
aaaaatggccacaacctcttcatctctgcggcggccgtgcctcccggaagcctcctcagc
ggccccggcctggccccggcggcggcgtccgcaggcggcgcggcgtcctccgcccagacg
caccggtccttcctgggccccttcnncgccgggccgcagttcgcgctcggccccatgtcc
ctgcaggccaacctcggctccgtggccggctcctccgtgctgcagtcgctgttcagctct
gtgccggccgccgcaggcctggtgcacgtgtcgtccgctgccaccagactgaccaactcg
cacgccatgggcagcttttccggggtggcaggcggcacagttggagaaggccaccgtgcg
cagggccaccagagcattactttctcccgtggaggtcacctgctaagtgtggccgcccgg
gctctggcaaggctctgggagctggtgttggctaacgccgccttgcctcctcccccaacg
ctgctggcctctaaccctgagcccgcgcttctgcagagcctcgcgtccctcccgcctaac
caagctttcttgccccccacctctgctgcctctctgccgcctgctaacgcctctttgtct
atcaagctcacctccctcccgcacaagggcgcccgcccctccttcacggtgcaccaccag
cccctgccccggctggccctggcccaggccgcgcccgggatcccacaggccagcgccacg
gggccgtccgcggtgtgggtgtccctcggcatgccgcctccctatgccgcgcacctttcg
ggggttaagccgcgataa

DBGET integrated database retrieval system