KEGG   Pan paniscus (bonobo): 100969609Help
Entry
100969609         CDS       T02283                                 

Definition
glutathione S-transferase A3-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100969609
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100969609
   00982 Drug metabolism - cytochrome P450
    100969609
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100969609
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100969609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 222 aa AA seqDB search
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLEKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSQADISLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPADEKALEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaagcccaagcttcactacttcaatggacggggcagaatggagcccatccgg
tggctcttggctgcagctggagtggagtttgaagagaaatttataggatctgcagaagat
ttggaaaagttaagaaatgatgggagtttgatgttccagcaagtaccaatggttgagatt
gatgggatgaagttggtacagaccagagccattctcaactacattgccagcaaatacaac
ctctacgggaaagacataaaggagagagccctaattgatatgtatacagaaggtatggca
gatttgaatgaaatgatccttcttctgcccttatgtcgacctgaggaaaaagatgccaag
attgccttgatcaaagagaaaacaaaaagtcgctatttccctgccttcgaaaaagtgtta
cagagccatggacaagactaccttgttggcaacaagctgagccaggctgacattagcctg
gtggaacttctctactatgtggaagagcttgactccagccttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacagtgaagaagtttctacagcct
ggcagcccaaggaaacctcccgcagatgaaaaagctttagaagaagccagaaagattttc
aggttttaa

DBGET integrated database retrieval system