KEGG   Pan paniscus (bonobo): 100969648Help
Entry
100969648         CDS       T02283                                 

Gene name
LAMB2
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
pps  Pan paniscus (bonobo)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pps04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:pps04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:pps04510]
Human Diseases; Cancers; Pathways in cancer [PATH:pps05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:pps05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:pps05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:pps05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1798 aa AA seqDB search
MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
TAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWHPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPK
DDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLIRTGGSAQPETPYSGPGLLIDSLVL
LPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLFISLSTLIYNGA
LPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHT
GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQQIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGQCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCA
PNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC
RACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRV
VQDLAARTRRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIEEATEHLTQLEAELTDVQDENFNANHALSGLERDTLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFN
SKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELRELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGI
AQGAIRGAVADTRDTEQTLYQVQERMAGAEQALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5397 nt NT seq  +upstreamnt  +downstreamnt
atggagctgacctcaagggaaagagggaggggacagcctctgccctgggaacttcgactg
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttccaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacttgtggcctgaatggcccccagccctactgcatcgtcagt
cacctgcaggacgaaaagaagtgcttcctttgtgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
acagcctggtggcagtcagagaatggtatccctgcggtcaccatccagctggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcccccccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgctggaccctgccatccctatcccagacccctacagctcacggattcagaacctgttg
aagatcaccaacctacgggtgaacctgactcgtctacacacgttgggagacaacctactc
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctacggacacgcctcagagtgtgcacccgccccaggggcaccagcc
catgctgagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgcgagcagtgtcaggatttctatcgtgacctgccctggcatccggctgaggacggccat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gccgtatacctggcatctggcaatgtgagtggaggtgtgtgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaggac
ctgcgggatccggctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggt
ggtcgctgtgattcccatgatgaccctgcactgggactggtctccggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccagcaatgccgtgatggcttctttgggctcagc
atcagtgaccctctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctggg
agcactccttgtgaccccaacagtggatcctgttactgcaaacgtctagtgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctgctcggctgccgc
ccctgtgactgcgacgtgggtggtgctttggatccccagtgtgatgagggcacaggtcaa
tgccactgccgccagcacatggttgggcgacgctgtgagcaggtgcaacctggctacttc
cggcccttcctggaccacctaatttgggaggctgaggacacccgagggcaggtgctcgat
gtggtggagcgcctggtgacccccggggaaactccatcctggactggctcaggctttgtg
cggctacaggaaggtcagaccctggagttcctggtggcctctgtgccgaaggctatggac
tatgacctgctgctgcgcttagagccccaggtccctgagcaatgggcagagttggaactg
attgtgcagcgtccagggcccgtgcctgcccacagcctgtgtgggcatttggtgcccaag
gatgatcgcatccaagggactctgcaaccacacgccaggtacttgatatttcctaatcct
gtctgccttgagcctggtatctcctacaagctgcatctgaagctgatacggacaggggga
agtgcccagcctgagactccctactctggacctggcctgctcattgactcgctggtgctg
ctgccccgtgtcctggtgctagagatgtttagtgggggtgatgctgctgccctggagcgc
caggccacctttgaacgctaccaatgccatgaggagggtctggtgcccagcaagacttct
ccctctgaggcctgcgcacccctcttcatcagcctgtccaccctcatctacaatggtgcc
ctgccatgtcagtgcaaccctcaaggttcactgagttctgagtgcaaccctcatggtggt
cagtgcctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctac
tatggctttggccccacaggctgtcaagcctgccagtgcagccacgagggggcactcagc
agtctctgtgaaaagaccagtgggcaatgtctctgtcgaactggtgcctttgggcttcgc
tgtgaccgctgccagcgtggccagtggggattccctagctgccggccatgtgtctgcaac
gggcatgcagatgagtgcaacacccacacaggcgcttgcctgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggtttccacggggacccacggctgccatat
gggggccagtgccggccctgtccctgtcctgaaggccctgggagccaacggcactttgct
acttcttgccaccgggatgaatattcccagcagattgtgtgccactgccgggcaggctat
acggggctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggt
ggccagtgccaactgtgtgagtgcagtgggaacattgacccaatggatcctgatgcctgt
gacccccacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcc
cactgcaagcctggcttccatggacaggctgcccgacagagctgtcaccgctgcacatgc
aacctgctgggcacaaatccgcagcagtgcccatctcctgaccagtgccactgtgatcca
agcagtgggcagtgcccatgcctccccaatgtccagggccctagctgtgaccgctgtgcc
cccaacttctggaacctcaccagtggccatggttgccagccttgtgcctgccacccaagc
cgggccagaggccccacctgcaatgagttcacagggcagtgccactgccgtgccggcttt
ggagggcggacttgttctgagtgccaagagctccactggggagaccctgggttgcagtgc
cgtgcctgtgattgtgactctcgtggaatagatacacctcagtgtcaccgcttcacaggt
cactgcagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgcccgcggcttc
tcaggaatctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtg
gtgcaggacttggctgcccgtacacggcgcctagagcagcgggcgcaggagttgcaacag
acgggtgtgctgggtgcctttgagagcagcttctggcatatgcaggagaagctgggcatt
gtgcagggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggag
gccacagaggagctgcggcgtgaaattgaggaggccactgagcacctgactcagctcgag
gcagagctgacagatgtgcaagatgagaacttcaatgccaaccatgcactaagtggtctg
gagcgagatacgcttgcacttaatctcacactgcggcagctcgaccagcatcttgacttg
ctcaaacattcaaacttcctgggtgcctatgacagcatccggcatgcccatagccagtct
gcagaggcagaacgtcgtgccaatacctcagccctggcagtacctagccctgtgagcaac
tcggcaagtgctcggcatcggacagaggcactgatggatgctcagaaggaggacttcaac
agcaaacacatggccaaccagcgggcacttggcaagctctctgcccatacccacaccctg
agcctgacagacataaatgagctggtgtgtggggcaccaggggatgcaccctgtgctaca
agcccttgtgggggtgccggctgtcgagatgaggatgggcagccccgctgtgggggcctc
agttgcaatggggcagcggctacagcagacctagcactgggccgggcccggcacacacag
gcagagctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagact
cgtcggcaggcaagcgaggcacagcagcgggcccaggcagccctggacaaggctaatgct
tccaggggacaggtggaacaggccaaccaggaacttcgagaacttatccagagtgtgaag
gacttcctcaaccaggagggggctgatcctgatagcattgaaatggtggccacacgggtg
ctagagctctccatcccagcttcagctgagcagatccagcacctggcgggtgcgattgca
gagcgagtccggagcctggcagatgtggatgcgatcctggcacgtactgtaggagatgtg
cgtcgtgccgagcagctactgcaggatgcacggcgggcaaggagctgggctgaggatgag
aaacagaaggcagagacagtacaggcagcactggaggaggcccagcgggcacagggtatt
gcccagggtgccatccggggggcagtggctgacacacgggacacagagcagaccctgtac
caggtacaggagaggatggcaggtgcagagcaggcactgagctctgcaggtgaaagggct
cggcagttggatgctctcctggaggctctgaaattgaaacgggcaggaaatagtctggca
gcctctacagcagaagaaacggcaggcagtgcccagggtcgtgcccaggaggctgagcag
ctgctacggggtcctctgggtgatcagtaccagacggtgaaggccctagctgagcgcaag
gcccaaggtgtgctggctgcacaggcaagggcagaacaactgcgggatgaggctcgggac
ctgttgcaagccgctcaggacaagctgcagcggctacaggaattggaaggcacctatgag
gaaaatgagcgggcactggagagtaaggcagcccagttggacgggttggaggccaggatg
cgcagcgtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

DBGET integrated database retrieval system