KEGG   Pan paniscus (bonobo): 100969982Help
Entry
100969982         CDS       T02283                                 

Gene name
USP19
Definition
(RefSeq) ubiquitin specific peptidase 19
  KO
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100969982 (USP19)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100969982 (USP19)
Ubiquitin system [BR:pps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100969982 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 1384 aa AA seqDB search
MSGGASATGPRRGPPGLEDTTSKKKQKDRANQESKDGGPRKETGSRYVAQAGLELLASGD
PSASASHAAGITGSHHHTRLFFPSSSGSASTPQEEQTKEGACEDPHDLLATPPPELLLDW
RQSAEEVIVKLRVGVGPLQLEDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTG
KGSLLHLTLPKKVPMLTWPSLLKKPLGTQELVPGLQCQENGQELSPIALEPGPEPHRAKQ
EARNQKRAQGRGEVGSGAGPGAQAGPSAKRAVHLCRGPEGDGSRDDPGPQGDAPPFVADP
ATQVEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCA
KEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQD
FTLIFQTRDGNFLRLHPGCGPHATFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQR
WGGLEAPAARGAVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDT
GLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFT
GLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLRAL
WKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVD
SDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLP
QKQKVLPVFYFAREPHSKPIKFLVSVSKENSTASEVLDSLSQSVHVKPENLRLAEVIKNR
FHRVFLPSHSLDTVSPSDMLLCFELLSSELAKERVVVLEVQQRPQVPSVPISKCAACQRK
QQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLA
QLLEGYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTGSLEAGDSERDPIQPPELQLVT
PMAEGDTGLPRVWAAPDRGPVPSTSGISSEMLASGPIEVGSLPAGERVSRPEAAVPGYQH
PSEAMNAHTPLFFIYKIDSSNREQRLEDKGDTPLELGDDCSLALVWRNNERLQEFVLVAS
KELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLW
RLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINH
YGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSP
VERPPRAGHSEHHPDLGPAAEAAASQGLGPGQAPEVAPTRTAPERFXPPVDRPAPTYSNM
EEVD
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggggccagtgccacaggcccaaggagagggcccccaggactggaggacacc
actagtaagaagaagcagaaggatcgagcaaaccaggagagcaaggatggaggtcctagg
aaagagacagggtctcgatatgttgcccaggctggtcttgaacttctggcctcaggtgat
ccttctgcctcagcctcccatgcagctgggatcacaggctcacaccaccatacccggctg
ttctttccttcatcgtcagggtcagcatccactcctcaagaggagcagaccaaagaggga
gcttgtgaagaccctcatgatctcttggctactccccctccagagttgttgctcgattgg
aggcagagtgcagaagaggtgattgtcaagcttcgtgtgggagtaggtcccctgcagctg
gaggatgtagatgctgctttcacagatacggactgtgtggtgcggtttgcaggtggtcag
cagtggggtggtgtcttctatgctgagataaaaagctcttgtgctaaagtgcaaaccggc
aagggcagtctcctgcacctgacactgcccaaaaaggtgcctatgctcacgtggccctcc
ctcctgaagaaacctctagggacccaggagctggtgccggggctgcagtgccaggagaat
gggcaggaactgtctcccattgccctggagccaggccctgagccccaccgggctaagcag
gaggcccggaaccagaagcgggcccagggccgtggtgaggtaggctcaggggctggcccc
ggggcccaggcagggcccagcgccaagagggctgtgcatctctgcagagggccagagggg
gacgggtccagggatgaccctggaccccagggtgatgccccacccttcgtggctgaccca
gccacccaggttgaggctgatgaacagctttgcataccaccgctgaactcccaaacctgc
ctcctgggctcagaggagaatttagcccctttggcaggagagaaagcagtgcctcccggg
aatgacccagtctctccagccatggtccggagcagaaaccctgggaaagatgactgtgcc
aaggaggagatggcagtggcagcagatgctgcaaccttggtggatgagcccgagtcgatg
gtgaacctggcgtttgtcaagaatgactcgtatgagaagggcccggattcagtggtggtg
cacgtgtacgtgaaggagatctgcagggacacctcaagagtacttttccgtgagcaggac
ttcacgctcatcttccagaccagggatggaaacttcctgaggctgcacccgggctgtggg
ccccacgccaccttccgttggcaggtgaagctcaggaatctgattgagccagagcagtgc
accttctgtttcacggcttctcgcatcgacatctgccttcgtaagaggcagagtcagcgc
tgggggggcctggaggccccagctgcacgaggtgcagtgggtggtgcaaaggttgccgtg
ccgacaggtccaacccctctggattcaaccccaccaggaggtgctccccacccgctgaca
ggccaggaggaggcccgggctgtggagaaggataaatccaaggcacgatctgaggacaca
gggctagacagtgtggcaacccgcacacccatggagcatgtaaccccaaagccagagaca
cacctggcctcgcccaagcctacatgcatggtgcctcccatgccccacagcccagttagt
ggagacagcgtggaggaggaggaagaggaagagaagaaggtgtgtctgccaggcttcact
ggccttgtcaatttaggcaacacctgcttcatgaacagcgtcattcagtctctgtccaac
actcgggaactccgggacttcttccatgaccgctcctttgaggctgagatcaactacaac
aacccactagggactggtgggcgtctggccattggctttgccgtgctgcttcgggcgctg
tggaagggcacccaccatgccttccagccttccaagttgaaggccattgtggcgagtaag
gccagccagttcacaggctatgcacagcatgatgcccaggagttcatggctttcctgctg
gatgggctgcacgaggacctgaatcgcattcagaacaagccctacacagagaccgtggat
tcagatgggcggcccgatgaggtggtagctgaggaagcatggcagcggcacaagatgagg
aatgactctttcatcgtggacttatttcaggggcagtacaagtcgaagctggtgtgccct
gtgtgtgccaaggtctccatcacttttgacccgtttctttatctgccggtgcccttgcca
caaaagcaaaaggttctccctgtcttttattttgcccgagagccccacagcaagcccatc
aagttcctggtgagcgtcagcaaggagaactccactgcgagcgaagtattggactccctc
tctcagagtgttcatgtgaagcctgagaacctgcgtttggcggaggtaattaagaatcgt
ttccatcgtgtgttcctaccctcccactcactggacactgtgtccccatctgatatgctc
ctctgctttgagctgctatcctcagagttggctaaggagcgggtagtggtgctagaggtg
caacagcgcccccaggtgcccagcgtccccatctccaagtgtgcagcctgccagcggaag
caacagtcggaggatgaaaagctgaagcgctgtacccggtgctaccgtgtgggctactgc
aaccagctctgccagaaaacccactggcctgaccacaagggcctctgccgacctgagaac
attggctaccccttcctggtcagtgtacctgcctcgcgcctcacttatgcccgcctcgct
cagttgctagagggctatgcccggtactctgtgagtgtattccagccaccctttcagcca
ggccgcatggccttggagtctcagagccctggctgcaccacactgctctccactggctcc
ctggaggctggggacagcgagagagaccccattcagccacctgagctccagctggtgacc
cctatggctgagggggacacagggcttccccgggtgtgggcagcccctgaccggggtcct
gtgcccagcaccagtggaatttcttctgagatgctggccagtgggcccattgaggttggc
tccttgcctgctggcgagagggtgtcccgacccgaagctgctgtgcctgggtaccagcat
ccaagtgaagctatgaatgcccacacacccctgttcttcatctataaaattgattcatcc
aaccgagagcagcggctagaggacaaaggagacaccccactggagctgggtgacgactgt
agcctggctctcgtctggcggaacaatgagcgcttgcaggagtttgtgttggtagcctcc
aaggagctggaatgtgctgaggatccaggctctgccggtgaggctgcccgggccggccac
ttcaccctggaccagtgcctcaacctcttcacacggcctgaggtgctggcacccgaggag
gcctggtactgcccacagtgcaaacagcaccgtgaggcctccaagcagctgttgctatgg
cgcctgccaaatgttctcattgtgcagctcaagcgcttctcctttcgtagttttatctgg
cgtgacaagatcaatgacttggtggagttccctgttaggaacctggacctgagcaagttc
tgcattggtcagaaagaggagcagctgcccagctacgatctatatgctgtcatcaaccac
tatggaggcatgattggtggccactacactgcctgtgcacgcctgcccaatgatcgtagc
agtcagcgcagtgacgtgggctggcgcttgtttgatgacagcacagtgacaacggtagac
gagagccaggttgtgacgcgttacgcctatgtactcttctaccgccggcggaactctcct
gtggagaggccccccagggcaggtcactctgagcaccacccagacctaggccctgcagct
gaggctgctgccagccagggattaggccctggccaggcccccgaggtggcccccacgcgg
acagcccctgaacgcttcngcccccctgtggatcggccagcccccacctacagcaacatg
gaggaggtggattag

DBGET integrated database retrieval system