KEGG   Pan paniscus (bonobo): 100970018Help
Entry
100970018         CDS       T02283                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100970018 (GSTO2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100970018 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    100970018 (GSTO2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100970018 (GSTO2)
   05204 Chemical carcinogenesis
    100970018 (GSTO2)
   05225 Hepatocellular carcinoma
    100970018 (GSTO2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100970018 (GSTO2)
  Drug resistance
   01524 Platinum drug resistance
    100970018 (GSTO2)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100970018 (GSTO2)
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100970018 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
10
AA seq 243 aa AA seqDB search
MSEDATRTLGKGSQPPGPVPEGLIRIYSMRFCPFSHRTRLVLKAKNIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTDLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggatgcgaccaggaccctggggaaaggaagccagcccccagggccagtcccg
gaggggctgatccgcatctacagcatgaggttctgccccttttctcacaggacccgcctc
gtcctcaaggccaaaaacatcagacatgaagtggtcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccacattcctgtcctggagaccagccaatgc
caactgatctatgaatctgttattgcttgtgagtacctggatgacgcttatccaggaagg
aagctgtttccatatgacccttatgaacgagctcgccaaaagatgttattggagctattt
tgtaaggtcccacatttgaccaaggagtgcctggtagcgttgagatgtgggagagaatgc
actgatctgaaggcagccctgcgtcaggaattcagcaacctggaagagattcttgagtat
cagaacaccaccttctttggtggaacctgtatatccatgattgattacctcctctggccc
tggtttgagcggctggatgtgtatgggatactggactgtgtgagccacacgccagccctg
cggctctggatatcagccatgaagtgggaccccacagtctgtgctcttctcatggataag
agcattttccagggcttcttgaatctctattttcagaacaaccctaatgcctttgacttt
gggctgtgctga

DBGET integrated database retrieval system