KEGG   Pan paniscus (bonobo): 100970018Help
Entry
100970018         CDS       T02283                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00480  Glutathione metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps00983  Drug metabolism - other enzymes
pps01524  Platinum drug resistance
pps05200  Pathways in cancer
pps05204  Chemical carcinogenesis
pps05225  Hepatocellular carcinoma
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100970018 (GSTO2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100970018 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    100970018 (GSTO2)
   00983 Drug metabolism - other enzymes
    100970018 (GSTO2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100970018 (GSTO2)
   05204 Chemical carcinogenesis
    100970018 (GSTO2)
   05225 Hepatocellular carcinoma
    100970018 (GSTO2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100970018 (GSTO2)
  Drug resistance
   01524 Platinum drug resistance
    100970018 (GSTO2)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100970018 (GSTO2)
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100970018 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 100970018
NCBI-ProteinID: XP_003825601
Position
10
AA seq 243 aa AA seqDB search
MSEDATRTLGKGSQPPGPVPEGLIRIYSMRFCPFSHRTRLVLKAKNIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTDLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggatgcgaccaggaccctggggaaaggaagccagcccccagggccagtcccg
gaggggctgatccgcatctacagcatgaggttctgccccttttctcacaggacccgcctc
gtcctcaaggccaaaaacatcagacatgaagtggtcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccacattcctgtcctggagaccagccaatgc
caactgatctatgaatctgttattgcttgtgagtacctggatgacgcttatccaggaagg
aagctgtttccatatgacccttatgaacgagctcgccaaaagatgttattggagctattt
tgtaaggtcccacatttgaccaaggagtgcctggtagcgttgagatgtgggagagaatgc
actgatctgaaggcagccctgcgtcaggaattcagcaacctggaagagattcttgagtat
cagaacaccaccttctttggtggaacctgtatatccatgattgattacctcctctggccc
tggtttgagcggctggatgtgtatgggatactggactgtgtgagccacacgccagccctg
cggctctggatatcagccatgaagtgggaccccacagtctgtgctcttctcatggataag
agcattttccagggcttcttgaatctctattttcagaacaaccctaatgcctttgacttt
gggctgtgctga

DBGET integrated database retrieval system