KEGG   Pan paniscus (bonobo): 100970130Help
Entry
100970130         CDS       T02283                                 

Definition
uncharacterized LOC100970130
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:pps00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 758 aa AA seqDB search
MLGGSLTFSSWVGGVESTLPMWGSLVVDLETTKALQSQKWPVGMGSAGREALGQSPSGAG
TQPPASSSGRQARAGVVAGRSRALSTDRAKRPQGPARAPEGDSLAGGTRRFLSLRTQSSV
GPRAGAGEATLPRGTSRARGTGSCGAGGLQAAARASRKAGDRGFWARSFTGSSPPPPRGS
RMSGGRPARETGCQGAPGAGLQGAPREPLGPRAGCRDRAPRYQGYEGRAGPMGTRARRRR
PFLAGVPGDPRPPPAPLAPPRSPPSMSCYFQXXXXXXXAAAPASETLRPGKPAGRWARPR
CGCLGPAGRMGAVARPGGGLVSGVPRGPGESGVPRRRGGLQPLLAPPRSPPSMSCYFQHL
PPDPGRGRGSGPPCPPPSPSLGHGGQAPRLTGNSLQTPNAEAPREGEVGKFNAKRKPKCY
ALLPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQHVSLPRMVYPQPK
VLTPWKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLET
AEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFC
ERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYI
PKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPT
KVLSPEYLWDQQLLGWPSVLRKLRFTAVPKNHQAVRNP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcggcagcctaaccttcagctcatgggtgggtggagtggagagcaccctcccc
atgtggggctccctggtcgtggacctggagaccaccaaggctctgcagtctcagaagtgg
cctgttggaatggggtctgcaggcagggaagccttgggccagagtccctcaggggcagga
acacagcccccagcttcctcgagcggacgccaggcaagggcgggggtcgtagcggggcgg
agcagggctttgtccacggaccgcgcgaagaggcctcagggcccggcgcgggcgccggag
ggggactcgctcgcagggggaacgcgaaggttcctcagtctgcggacgcagagctccgtg
gggccgcgagccggggccggggaagcgactctgcctagggggacgtcgcgggcgcggggc
acagggtcctgcggggctggagggctacaggctgcggcgcgcgcgagccggaaggccggg
gatcgtgggttctgggcccgcagcttcacgggttcgtctcccccacctccccgggggagc
aggatgtcagggggtcgccccgcccgggagacagggtgtcaaggggcccccggggcgggg
cttcagggggcaccccgggagccgctcggccccagggcgggatgcagggacagggcccca
aggtaccagggctacgaggggcgcgcgggtcccatggggacgcgcgcgaggaggcgccgt
cccttcctagcaggggtccctggggacccgcggccgcctcccgcgcccctcgcccctcca
cgctccccgccttccatgagctgctattttcagnnnnnnnnnnnnnnnnnnnnggccgcc
gccccagcctccgagaccctgcgtcctgggaagccggcgggcaggtgggctcggccgcgc
tgtgggtgcctgggacccgcagggaggatgggcgcggtggcgcggcctggcggggggctc
gtctccggggtcccccggggtcctggtgagagcggggtccctcgacgccgtggcggtctc
cagcctctcctcgcccctccacgctccccgccttccatgagctgctattttcagcaccta
ccgcccgaccctggacgaggacgaggctctgggccgccctgcccgccccccagcccttcc
ctcgggcatggcggccaggcgcccaggttgaccgggaacagcctccaaaccccaaacgcg
gaggcgcctcgggaaggcgaggtgggcaagttcaatgccaagcgaaaaccaaaatgctac
gcacttctacctatgatccttttcctaataatgcttgtcttggtcttgtttggttacggg
gtcctaagccccagaagtctaatgccaggaagcctggaacgggggttctgcatggctgtt
agggaacctgaccatctgcagcacgtctcgttgccaaggatggtctacccccagccaaag
gtgctgacaccgtggaaggatgtcctcgtggtgaccccttggctggctcccattgtctgg
gagggcacgttcaacatcgacatcctcaacgagcagttcaggctccagaacaccaccatt
gggttaactgtgtttgccatcaaaaaatacgtggctttcctgaagctgttcctggagacg
gcggagaagcacttcatggtgggccaccgtgtccactactatgtcttcaccgaccagcca
gccgcagtgccccgcgtgacgctggggaccggtcggcagctgtcggtgctggaggtgcgc
gcctacaagcgctggcaggacgtgtccatgcgccgcatggagatgatcagtgacttctgc
gagcggcgcttcctcagcgaggtggattacctggtgtgcgtggacgtggacatggagttc
cgcgaccacgtgggcgtggagatcctgactcccctgttcggcaccctgcaccctggcttc
tacggaagcagccgggaggccttcacctacgagcgccggccccagtcccaggcctacatc
cccaaggacgagggcgatttctactacctgggggggttcttcggagggtcggtgcaagag
gtgcagcggctcaccagggcctgccaccaggccatgatggtcgaccaggccaacggcatc
gaggccgtgtggcacgacgagagccacctgaacaagtacctgctgcgccacaaacccacc
aaggtgctctcccccgagtacttgtgggaccagcagctgctgggctggccctccgtcctg
aggaagctgaggttcactgcggtgcccaagaaccaccaggcggtccggaacccgtga

DBGET integrated database retrieval system