KEGG   Pan paniscus (bonobo): 100970348Help
Entry
100970348         CDS       T02283                                 

Gene name
LYPLA1
Definition
lysophospholipase I
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100970348 (LYPLA1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100970348 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 181 aa AA seqDB search
MGRSLCRPVRPVTLNMNMAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIP
SNRIILGGFSQGGALSLYTALTMQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQC
HGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPI
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaagcctttgcaggcctgttaggcctgttacattaaatatgaacatggctatg
ccttcatggtttgatattattgggctttcaccagattcacaggaggatgaatctgggatt
aaacaggcagcagaaaatataaaagctttgattgatcaagaagtgaagaatggcattcct
tctaacagaattattttgggagggttttctcagggaggagctttatctttatatactgcc
cttaccatgcagcagaaactggcaggtgtcactgcactcagttgctggcttccacttcgg
gcttcctttccacagggtcctatcggtggtgctaatagagatatttctattctccagtgc
catggggattgtgacccgttggttcccctgatgtttggttctcttacggttgaaaaacta
aaaacattggtgaatccagccaatgtgacctttaaaacctatgaaggtatgatgcacagt
tcgtgtcaacaggaaatgatggatgtcaagcaattcattgataaactcctacctccaatt
gattga

DBGET integrated database retrieval system