KEGG   Pan paniscus (bonobo): 100970917Help
Entry
100970917         CDS       T02283                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase, cAMP-dependent, catalytic, beta
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 357 aa AA seqDB search
MSARKSSDASACSSSEISDSFVKEFLAKAKEDFLKKWENPTQNNAGLEDFERXKTLGTGS
FGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDN
SNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLL
IDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAA
GYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKT
HKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacgcaaatcatcagatgcatctgcttgctcctcttcagaaatatctgattcc
tttgtgaaagagtttctagccaaagccaaagaagactttttgaaaaaatgggagaatcca
actcagaataatgccggacttgaagattttgaaaggnaaaaaacccttggaacaggttca
tttggaagagtcatgttggtaaaacacaaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaaga
atattacaggcagtgaattttcctttccttgttcgactggagtatgcttttaaggataat
tctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcacatctaaga
agaattggaaggttcagtgagccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccatcaaggctatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggaactccagagtatttggctccagaaataattctcagcaag
ggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggcagct
ggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggtccgattcccatcccacttcagttcagatctcaaggaccttctacggaacctgctg
caggtggatttgaccaagagatttggaaatctaaagaatggtgtcagtgatataaaaacc
cacaagtggtttgccacgacagattggattgctatttaccagaggaaggttgaagctcca
ttcataccaaagtttagaggctctggagataccagcaactttgatgactatgaagaagaa
gatatccgtgtctctataacagaaaaatgtgcaaaagaatttggtgaattttaa

DBGET integrated database retrieval system