KEGG   Pan paniscus (bonobo): 100970943Help
Entry
100970943         CDS       T02283                                 

Gene name
LYZ, LZM
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:pps04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 148 aa AA seqDB search
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattgttctggggcttgtcctcctttctgttaccgtccagggcaaggtc
tttgaaaggtgtgagttggccagaactctgaaaagattgggaatggatggctacagggga
atcagcctagcaaactggatgtgtttggccaaatgggagagtggttataacacacgagct
acaaactacaatgctggagacagaagcactgattatgggatatttcagatcaatagccgc
tactggtgtaatgatggcaaaaccccaggagcagttaatgcctgtcatttatcctgcagt
gctttgctgcaagataacatcgctgatgctgtagcttgtgcaaagagggttgtccgtgat
ccacaaggcattagagcatgggtggcatggagaaatcgttgtcaaaacagagatgtccgt
cagtatgttcaaggttgtggagtataa

DBGET integrated database retrieval system