KEGG   Pan paniscus (bonobo): 100970943Help
Entry
100970943         CDS       T02283                                 

Gene name
LYZ, LZM
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100970943 (LYZ)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100970943 (LYZ)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100970943 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 148 aa AA seqDB search
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattgttctggggcttgtcctcctttctgttaccgtccagggcaaggtc
tttgaaaggtgtgagttggccagaactctgaaaagattgggaatggatggctacagggga
atcagcctagcaaactggatgtgtttggccaaatgggagagtggttataacacacgagct
acaaactacaatgctggagacagaagcactgattatgggatatttcagatcaatagccgc
tactggtgtaatgatggcaaaaccccaggagcagttaatgcctgtcatttatcctgcagt
gctttgctgcaagataacatcgctgatgctgtagcttgtgcaaagagggttgtccgtgat
ccacaaggcattagagcatgggtggcatggagaaatcgttgtcaaaacagagatgtccgt
cagtatgttcaaggttgtggagtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system