KEGG   Pan paniscus (bonobo): 100971072Help
Entry
100971072         CDS       T02283                                 

Definition
uncharacterized LOC100971072
Orthology
K05759  
profilin
Organism
pps  Pan paniscus (bonobo)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100971072
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100971072
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100971072
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100971072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 392 aa AA seqDB search
MDFEHEPSSFPNKRPSLQTPDDGFRASLLYKQAAHSSQCGSFSLASRSPICNTFLTLVAS
SGKNCNFLATETQAELLREGREGLSVILRESSSSERLEVLPEARVRRGCRRRPRQAPLCP
PKASRPAAVLLHTRARPDGPGVVRLRLEGSPPASAERANVGAHRLRDAAQREHSAPCAAG
STASPRGRCRGGGGRLQAQRGLGGGSRWRVLVCGRGWSRCFSVTGAWPGQSCRRHPPATA
SVDGRVLGRRVLAGHHRAGWRPLPRVLGAREFTAHHPLPRLGSCSGTKPLEGSGGKRAPV
PEVTPSDVRTLVNGFAKNPLQARREGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHL
YLLVATYTEGMYPSICVEATESLGDYLRKKGS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaacacgaaccatccagtttccctaacaagaggccttcgctacagactcca
gatgacggcttcagagccagcctcctttataagcaggcagcccattccagccagtgtggc
agcttcagcctggcctctcggagtcccatttgcaacacttttctgactttggtggcctcg
agtgggaagaactgcaactttctggccacagaaacacaggctgagctgcttagagaaggc
agggaggggctttcggtcatactgcgcgagtcttcgagctctgagcggctcgaagtcctc
cccgaggcacgggtgcgacggggatgtcgtcgccggccgcgacaggcacctctctgccct
cccaaggccagcaggcccgcggccgtcctgctccacactcgggcccggcccgacggcccc
ggagtcgtccgactgcggctggaagggagcccgcccgcgtctgcggaacgcgcgaatgtt
ggcgcgcaccgtctccgggacgcagcgcagcgcgagcactccgccccctgcgccgcgggt
tccacagcgagtccgcgcgggcggtgccggggcggcggaggacggcttcaggcccaaagg
ggattgggcggcggctctaggtggcgggtcttggtttgcggaaggggctggagtcgctgc
ttctcggtgaccggcgcgtggcccggccaatcctgccgccgccacccacccgcaaccgcg
tccgttgacggtcgggtccttggtcgccgggtccttgcggggcaccacagagcggggtgg
cgtccgctccctcgagtcctcggtgccagggaattcaccgctcaccaccccctgccccgc
cttgggtcctgctcggggaccaaaccactggaaggcagtggcgggaaacgggcgcctgtg
ccggaggtaacgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttg
caagcccgaagagaaggactgtatttcaagggaaaagattacagatgtgtccgggcagat
gaatattctctttatgccaaaaatgagaacactggtgtggttgtcgtgaagacccatcta
tatcttctggtggcaacttacactgagggcatgtatcctagcatctgtgtggaagccaca
gagagcctgggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system