KEGG   Pan paniscus (bonobo): 100971072Help
Entry
100971072         CDS       T02283                                 

Gene name
PFN4
Definition
(RefSeq) profilin family member 4
  KO
K05759  
profilin
Organism
pps  Pan paniscus (bonobo)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100971072 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100971072 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100971072 (PFN4)
Membrane trafficking [BR:pps04131]
 Others
  Actin-binding proteins
   Others
    100971072 (PFN4)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100971072 (PFN4)
Exosome [BR:pps04147]
 Exosomal proteins
  Proteins found in most exosomes
   100971072 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2A
AA seq 129 aa AA seqDB search
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQAR
REGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESL
GDYLRKKGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta
acgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaagcccga
agagaaggactgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacactggtgtggttgtcgtgaagacccatctatatcttctg
gtggcaacttacactgagggcatgtatcctagcatctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system