KEGG   Pan paniscus (bonobo): 100971072Help
Entry
100971072         CDS       T02283                                 

Definition
uncharacterized LOC100971072
Orthology
K05759  
profilin
Organism
pps  Pan paniscus (bonobo)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:pps04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:pps04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:pps05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 392 aa AA seqDB search
MDFEHEPSSFPNKRPSLQTPDDGFRASLLYKQAAHSSQCGSFSLASRSPICNTFLTLVAS
SGKNCNFLATETQAELLREGREGLSVILRESSSSERLEVLPEARVRRGCRRRPRQAPLCP
PKASRPAAVLLHTRARPDGPGVVRLRLEGSPPASAERANVGAHRLRDAAQREHSAPCAAG
STASPRGRCRGGGGRLQAQRGLGGGSRWRVLVCGRGWSRCFSVTGAWPGQSCRRHPPATA
SVDGRVLGRRVLAGHHRAGWRPLPRVLGAREFTAHHPLPRLGSCSGTKPLEGSGGKRAPV
PEVTPSDVRTLVNGFAKNPLQARREGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHL
YLLVATYTEGMYPSICVEATESLGDYLRKKGS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaacacgaaccatccagtttccctaacaagaggccttcgctacagactcca
gatgacggcttcagagccagcctcctttataagcaggcagcccattccagccagtgtggc
agcttcagcctggcctctcggagtcccatttgcaacacttttctgactttggtggcctcg
agtgggaagaactgcaactttctggccacagaaacacaggctgagctgcttagagaaggc
agggaggggctttcggtcatactgcgcgagtcttcgagctctgagcggctcgaagtcctc
cccgaggcacgggtgcgacggggatgtcgtcgccggccgcgacaggcacctctctgccct
cccaaggccagcaggcccgcggccgtcctgctccacactcgggcccggcccgacggcccc
ggagtcgtccgactgcggctggaagggagcccgcccgcgtctgcggaacgcgcgaatgtt
ggcgcgcaccgtctccgggacgcagcgcagcgcgagcactccgccccctgcgccgcgggt
tccacagcgagtccgcgcgggcggtgccggggcggcggaggacggcttcaggcccaaagg
ggattgggcggcggctctaggtggcgggtcttggtttgcggaaggggctggagtcgctgc
ttctcggtgaccggcgcgtggcccggccaatcctgccgccgccacccacccgcaaccgcg
tccgttgacggtcgggtccttggtcgccgggtccttgcggggcaccacagagcggggtgg
cgtccgctccctcgagtcctcggtgccagggaattcaccgctcaccaccccctgccccgc
cttgggtcctgctcggggaccaaaccactggaaggcagtggcgggaaacgggcgcctgtg
ccggaggtaacgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttg
caagcccgaagagaaggactgtatttcaagggaaaagattacagatgtgtccgggcagat
gaatattctctttatgccaaaaatgagaacactggtgtggttgtcgtgaagacccatcta
tatcttctggtggcaacttacactgagggcatgtatcctagcatctgtgtggaagccaca
gagagcctgggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system