KEGG   Pan paniscus (bonobo): 100971299Help
Entry
100971299         CDS       T02283                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 501 aa AA seqDB search
MQSPLHLAVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKAQH
TVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHRKRKLLENSTL
NSKLLKVNVISKCICRLHQLSLQSYSFLFKIFFPSFXNSNIEQFCCYFKELPAVELRNGK
TAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQ
DAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQ
NEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDE
TELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKC
YLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVV
KAKAYILFYVEHQAKAGSDKL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaccactacacttggcagtgtgccggtccaacaaaagcccttgggtctgtttg
acttgttcaagtgtccactgtggaaggtatgtgaatggccatgcaaaaaaacattatgaa
gatgcacaagtacccttaaccaaccataagaaatcagaaaagcaagataaagctcagcac
acagtatgtatggattgcagtagctacagtacatactgttatcgctgtgatgattttgtg
gttaatgacaccaagctgggactggtacagaaagtcagagaacacttacagaacttggaa
aactcagcgttcacagctgacaggcataggaaaagaaaacttttggaaaactcaacacta
aacagcaagttattaaaagtaaatgtaatttcaaaatgtatatgtaggcttcatcaactt
tctttacagtcctattcttttctttttaaaatatttttcccttccttttaaaatagtaac
attgagcagttttgctgttatttcaaagaactgcccgccgtggagttaaggaatgggaaa
acagcaggaaggcggacataccacaccaggagccaaggggataacaatgtgtctttggta
gaagagtttagaaagacactctgtgctttatggcaaggcagccagactgcatttagccca
gagtccttattttatgttgtttggaagattatgccaaactttaggggctatcaacagcag
gacgcccatgaattcatgcgctaccttttggaccacctacacttggaacttcagggcggt
ttcaacggtgtttcccgctcggcaattctgcaggagaattctactctgtctgcaagtaac
aagtgttgcataaatggagcatctactgttgtcacggctatattcggaggcattctccaa
aatgaggttaactgcctcatatgtgggacagaatctagaaagtttgatccattcctagac
ctttcattagatattccaagtcagttcagaagtaagcgctctaagaatcaagaaaatgga
ccagtttgttcgttacgagattgtcttcgcagttttaccgacttagaagaacttgatgag
acagagttatatatgtgccataaatgcaaaaagaaacaaaagtccacaaaaaagttttgg
attcaaaaactacccaaggtgctatgcttacatttgaaaagatttcattggacagcatat
ttaagaaataaagttgatacatacgtagaatttccactgagaggcctagacatgaaatgc
tacttactagagcctgagaacagtggcccggagagctgcctgtatgacctcgccgctgtg
gtggtgcaccatggttccggggttggttctggacattacacagcatacgcaactcacgaa
ggccgctggttccacttcaatgacagtactgtaacactgactgacgaggagactgtggtg
aaggcgaaggcctacatccttttctacgtggaacaccaggccaaagctggatcggataaa
ctttaa

DBGET integrated database retrieval system