KEGG   Pan paniscus (bonobo): 100971503Help
Entry
100971503         CDS       T02283                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100971503 (RASGRF2)
   04010 MAPK signaling pathway
    100971503 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1237 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGPGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPH
TGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNT
ERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQE
RKATANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRS
IPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAV
ADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLR
ETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSY
RIDHQPKVTQYLLDKDLIIDEDTLYELSLKIEPRLPA
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggcctttctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggccgggaggcgtccgagatgcgctggacaagcagtattactttact
gttctttttggccatgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaacttgaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gatgaagatccagacatcaagaagattaaaaaggttcagagcttcatgcgaggatggttg
tgcagaaggaaatggaagaccatcgtgcaggattacatttgttctcctcatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtggaggcagagtcagagtacgttcac
cagctctacatcctggtcaacggctttctccggcccctgcgtatggccgccagctccaag
aagccccccatcagccacgacgacgtcagcagtatttttctcaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactaaaggcaaggatagcgaactggcccactttg
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctgcaagttctcgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaatccagcctgtgaggggaggatgctggagacattc
ttgacctatcccatgtttcagatccccagatatatcatcacactccatgagctccttgct
cacacaccccatgagcatgtggaaaggaaaagcctggagtttgccaaatcaaagctagag
gaactgtccagagtaatgcacgatgaagtcagcgacactgaaaacataaggaaaaacctt
gccatcgaaagaatgatcgtggagggctgtgacatcttgctggacaccagccaaacgttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaaacttagtaaagtt
cgcctgggttcgttgtctttgaaaaaggaaggagagagacaatgcttcttatttacaaaa
cactttttaatatgtacaagaagttcaggagggaagcttcatctgctcaagacaggtggg
gttctgtctctaatagactgcacgttgattgaggagccagatgcaagcgatgatgactct
aaaggttctgggcaagtgtttgggcacctggattttaaaatagtggtggagcctcccgac
gctgccgccttcactgttgtcttgttagcaccctcacgccaggagaaagctgcctggatg
agtgacatcagtcagtgtgtggacaatatacgatgtaatggtttaatgactatagtgttt
gaagagaattccaaagtcactgtgccacatatgattaagtctgatgcccgtcttcataaa
gacgacactgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tatgccagcgtggagcgcctcttggaacgactgacagacttgcggtttcttagtattgat
ttcctcaacacctttctgcacacctatcgtattttcactactgccgctgtggtgctgggg
aaactctccgacatatacaagaggcctttcacctccatccctgtcaggtcattggaattg
ttttttgctaccagccagaacaacagaggtgaacatttggtggatggcaaatccccacgt
ctgtgtcgcaaattctcttccccgccaccactggctgtgtccagaacatcttccccagtg
agggccagaaagctgtctttgacttctcccttgaactcaaagataggagcattggacctg
acaacttccagcagtcccaccaccaccacccagagtcccgctgcgtctccaccaccacac
actggtcagataccactggatctcagcagaggcctctcttctccagagcaaagcccggga
acggtagaagagaatgtcgataacccacgcgtggatctgtgtaacaagctaaaacgaagt
attcaaaaagcagtcctagagtctgcaccagcggaccgagcaggagtggaaagctcccct
gcagcggacaccacagaactttcaccttgcagatccccctcaactcctcggcacctccgc
tatcgccagcctggaggacagacggcggacaatgcccactgctctgtttcaccggcttct
gcttttgcaatagccacagctgcagcaggacatgggagtccaccaggctttaacaacacc
gagagaacatgtgataaagagtttattatacggagaacggctaccaatcgagttctgaac
gtcctccgtcactgggtctcaaagcacgcacaggatttcgaactcaacaatgaactaaag
atgaatgtcctaaatttgctagaagaagttttgcgagacccagaccttcttccccaagaa
aggaaagccaccgcgaatatcctcagggctctttcacaagatgaccaagatgacatccac
ctaaaattagaggatataattcaaatgactgactgcatgaaggccgaatgctttgagtcc
ttgtcggccatggagctggcagaacagatcaccctcctggaccatgtcattttcagaagc
attccctacgaggagtttcttgggcaggggtggatgaagctggataaaaacgaaagaact
ccttacattatgaaaaccagccaacacttcaatgacatgagtaacctggtggcctcccag
ataatgaactatgctgatgtcagctcccgtgccaacgccatcgagaaatgggtggcagtg
gcggacatctgccgatgcctgcacaactacaacggcgtgctggagatcacctcggcctta
aacagaagtgccatctacaggctgaagaaaacctgggccaaggtctctaagcagacaaaa
gctctaatggacaaacttcaaaagactgtttcctctgaaggaagatttaaaaatcttaga
gaaacccttaaaaattgtaaccctcctgcagttccttatcttgggatgtacttgacagac
ctggcatttattgaagaaggaacaccaaactttactgaggaaggccttgtcaatttctcc
aaaatgagaatgatatcacacatcatcagagagatacgccagttccagcagacttcctac
agaatagatcatcagccaaaggtcacacagtacttgcttgacaaagaccttatcatagat
gaagatacgctatatgagctgtcactaaaaattgaacctcgactccctgcttga

DBGET integrated database retrieval system