KEGG   Pan paniscus (bonobo): 100971639Help
Entry
100971639         CDS       T02283                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     100971639
Peptidases [BR:pps01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100971639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MRGLVVFLAVFALSEVNAITRVPLHKGKSLRRALKECRLLEDFLRNHHYAVSRKHSSSGV
VASESLTNYLDCQYFGKIYIGTPPQKFTLVFDTGSPDLWVPSVYCNSDACXNHQRFDPSK
SSTXQNMGKSLSIQYGTGSMWGLLGYDTVTVSNIVDPHQTVGLSTQEPGDIFTYSEFDGI
LGLAYPSLASEXSVPVFDNMMQRHLLAQDLFSVYMSRNDQGSMLTLRAIDLSYYTGSLHW
IPMTXQEYWQFTVDSVIIDGVVVACDGGCQAILDTGTSLLVGPGSNILNIQQAIGATVGQ
YNEFDIDCGLLSSVPTVVFEIHGKKYPLPPSAYTSQDQGFCTSGFQGDYSSQQWILGDVF
IREYYSVFDRANNRVGLAKAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccttgtggtgttccttgcagtctttgctctctctgaggtcaatgccatcacc
agggttcctctgcacaaagggaagtcgctgaggagggcactgaaggagtgcaggctcctg
gaggacttcctgaggaatcaccattatgcagtcagcaggaagcactccagctctggggtg
gtggccagcgagtctctgaccaactacctggattgtcagtactttgggaagatctacatc
gggacccctccccagaagttcaccttggtgtttgatacaggctccccggatctctgggtg
ccctctgtctactgcaacagtgatgcctgttaaaaccaccaacgcttcgatccgtccaag
tcctccaccncacagaacatgggcaagtccctgtccatccagtacggcacaggcagcatg
tggggcttgctgggctatgacactgtcaccgtctccaacattgtggacccccaccagact
gtgggcctgagcacccaggaacctggcgacatcttcacctactccgagtttgatgggatc
ctggggctggcctatccctcccttgcctctgagtagtcagtgccagtgtttgacaacatg
atgcagaggcacctgctggcccaggacctgttctcagtctacatgagcaggaatgaccag
gggagcatgctcacgctgagggccattgatctgtcctactacacaggctccctgcactgg
atacccatgactnngcaagaatactggcagttcactgtggacagtgtcatcattgatggc
gtggtggtggcctgtgacggtggctgtcaggccatcctggacaccggcacctccctgctg
gtggggcctggcagcaacatcctcaacatccagcaggccattggagccactgtgggccag
tacaatgagtttgacatcgactgcgggctcctgagcagcgtgcccacggttgtcttcgag
atccatggcaagaagtaccccctgccaccctccgcctacaccagccaggaccagggcttc
tgcaccagtggtttccagggtgactatagttcccagcagtggatcctcggggatgtcttc
atccgggagtattacagtgtctttgacagggccaataaccgtgtggggctggcgaaggct
gtctga

DBGET integrated database retrieval system