KEGG   Pan paniscus (bonobo): 100971729Help
Entry
100971729         CDS       T02283                                 

Gene name
MYL10
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
pps  Pan paniscus (bonobo)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100971729 (MYL10)
  Cell communication
   04510 Focal adhesion
    100971729 (MYL10)
   04530 Tight junction
    100971729 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100971729 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 193 aa AA seqDB search
MPWEVRQGVGADPRGRGRCKALSGTSQAPRRARKRAEGTASSNVFSMFDQSQIQEFKEAF
TIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGT
DPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYR
NLCYVITHGEEKD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccctgggaggtgagacagggggtgggggctgaccctcgaggcaggggccgctgcaag
gccttgtctggtacctcgcaggcaccgagaagagctcggaaaagagcagaaggcaccgcc
agctccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagaggctttc
accatcatggaccagaaccgcgatggcttcattgacaaagaggacttgagggacaccttt
gccgcgctgggccgcatcaatgtcaagaacgaggaactggaggccatggtgaaggaggcc
cccggacccatcaacttcactgtgttcctgaccatgtttggggagaagctgaagggcacg
gacccagaggagaccattctccacgccttcaaagtgttcgacactgaagggaaaggtttc
gtcaaggccgatgtcatcaaagaaaaacttatgacccaggcagaccgcttcagtgaggag
gaggtcaagcagatgtttgcagcgtttcccccagatgtgtgcggcaacctggactacaga
aacctgtgctacgtcatcactcacggtgaagagaaggattag

DBGET integrated database retrieval system