KEGG   Pan paniscus (bonobo): 100971729Help
Entry
100971729         CDS       T02283                                 

Gene name
MYL10
Definition
(RefSeq) myosin light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04510  Focal adhesion
pps04670  Leukocyte transendothelial migration
pps04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100971729 (MYL10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100971729 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100971729 (MYL10)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100971729 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_7 EF-hand_5 TC1
Motif
Other DBs
NCBI-GeneID: 100971729
NCBI-ProteinID: XP_008957488
Position
7
AA seq 226 aa AA seqDB search
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttaggctggtctcaaactcctggcctcaagtgatcctccctcctcggcctccc
aaagtgctgggattacaggcaccgagaagagctcggaaaagagcagaaggcaccgccagc
tccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagagagtctggct
ctgtcgcccaggctggagcgcaatggcatgatctcggctcactgcaacctctgcctcacg
ggttcgagcaattctcctgcctcagcctcccaagctttcaccatcatggaccagaaccgc
gatggcttcattgacaaagaggacttgagggacacctttgccgcgctgggccgcatcaat
gtcaagaacgaggaactggaggccatggtgaaggaggcccccggacccatcaacttcact
gtgttcctgaccatgtttggggagaagctgaagggcacggacccagaggagaccattctc
cacgccttcaaagtgttcgacactgaagggaaaggtttcgtcaaggccgatgtcatcaaa
gaaaaacttatgacccaggcagaccgcttcagtgaggaggaggtcaagcagatgtttgca
gcgtttcccccagatgtgtgcggcaacctggactacagaaacctgtgctacgtcatcact
cacggtgaagagaaggattag

DBGET integrated database retrieval system