KEGG   Pan paniscus (bonobo): 100972270Help
Entry
100972270         CDS       T02283                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 544 aa AA seqDB search
MCTAVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGQVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHHLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEG
VSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ
TALLRNGERPLGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASAQQVPPRLPPGARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLE
GHHV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccgcagtggaccctcgcattgtccggagatacctactcaggcggcagctcggg
cagggggcctatggcattgtgtggaaggcagtggaccggaggactggtgaagtcgtggcc
atcaagaaaatctttgatgcttttagggataagacagatgcccagagaacattccgggaa
atcacgctcctccaggagtttggggaccatcccaacatcatcagcctccttgacgtgatc
cgggcagagaacgacagggacatttacctggtgtttgagtttatggacactgacctgaac
gcagtcatccggaagggcggcctgctgcaggacgtccacgtgcgctccatcttctaccag
ctcctgcgggccacccggttcctccactcggggcaggttgtgcaccgggaccagaagccg
tccaatgtgctcctggatgccaactgcacagtgaagctgtgtgactttggcctggcccgc
tccctgggcgacctccctgaggggcctgaggaccaggccgtgacagagtacgtggccaca
cgctggtaccgagcaccggaggtgctgctctcttcgcaccgatacacccttggggtggac
atgtggagtctgggctgtatccttggggagatgctgcgggggagacccctgttcccgggc
acgtccaccctccaccagctggagctgatcctggagaccatcccaccgccatctgaggag
gacctcctggctctcggctcaggctgccgtgcctctgtgctgcaccacctggggtcccgg
ccacgacagacgctggatgccctcctaccgccagacacctccccagaggccttggacctc
cttaggcgactcctggtgttcgccccggacaagcggttaagtgcgacccaggcactgcag
cacccctacgtgcagaggttccactgccccagcgacgagtgggcacgagaggcagatgtg
cggccccgggcacacgaaggggtccagctctctgtgcctgagtaccgcagccgcgtctat
cagatgatcctggagtgtggaggcagcagcggcacctcgagagagaagggcccggagggt
gtctccccaagccaggcacacctgcacaaacccagagccgaccctcagctgccttctagg
acacctgtgcagggtcccagacccaggccccagagcagcccaggccatgaccccgccgag
cacgagtccccccgtgcagccaagaacgttcccaggcagaactccgctcccctgctccaa
actgcactcctaaggaatggggaaaggccccttggggcgaaggaagcgccccccttgaca
ctctcgctggtgaagccaagcgggaggggagctgcgccctccctgacctcccaggctgcg
gctcaggtggccaaccaggccctgatccggggtgactggaaccggggcggtggggtgagg
gtggccagcgcacaacaggtccctccccggcttcctccaggggcccggcccggccggagg
atgttcagcacctctgccttgcagggtgcccaggggggtgccagggctttgcttggaggc
tactcccaagcctacgggactgtctgccactcggcactgggccacctgcccctgctggag
gggcaccatgtgtga

DBGET integrated database retrieval system