KEGG   Pan paniscus (bonobo): 100972438Help
Entry
100972438         CDS       T02283                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100972438 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100972438 (ARG1)
   00330 Arginine and proline metabolism
    100972438 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100972438 (ARG1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100972438 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLADKVAEVKQNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGLAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagtccagaaccatagggattattggagctcctttctcaaagggacagcca
cgaggaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctg
gctgacaaggtggcagaagtcaagcagaacggaagaatcagcctggtgctgggcggagac
cacagtttggcaattggaagcatctctggccatgccagggtccaccctgatcttggagtc
atctgggtggatgctcacactgatatcaacactccactgacaaccacaagtggaaacttg
catggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgactccctgcatatctgccaaggatattgtgtatattggcttgaga
gacgtggaccctggagaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactaggaattggcaaggtgatggaagaaacactcagctatctacta
ggaagaaagaaaaggccaattcatctaagttttgatgttgacggactggacccatctttc
acaccagctactggcacaccagttgtgggaggtctgacatacagagaaggtctctacatc
acagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaaccca
tccctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataacc
ttggcttgtttcggacttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system